KEGG   Mycobacterium avium subsp. paratuberculosis MAP4: MAP4_0808Help
Entry
MAP4_0808         CDS       T02662                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mao  Mycobacterium avium subsp. paratuberculosis MAP4
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mao03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
878880..879731
Genome map
AA seq 283 aa AA seqDB search
MPELPEVEVVRRGLHAHVVGKTIGAVRVHHPRAVRRHEAGPADLTARLLGARITGTDRRG
KYLWLLLDGCDTALVVHLGMSGQMLLGAVPRAEHVRISALLDDGTVLSFADQRTFGGWML
ADLLEVDGSILPRPVAHLARDPLDPRFDAAAVVKVLRRKHSEIKRQLLDQQVVSGIGNIY
ADEALWRAKVHGARIAATMTGRQLTAVLDAAAEVMRDALAQGGTSFDSLYVNVNGESGYF
DRSLDAYGREGESCRRCGAVMRREKFMNRSSFYCPKCQPRPRL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaactgcccgaagtcgaggtggtgcgccgcggcctgcacgcgcacgtggtgggc
aagacgatcggcgcggtgcgggtgcatcacccccgcgcggtgcgccgccacgaagccggc
cccgccgacctcaccgcccggctgctgggcgcgcggatcaccggcaccgaccggcgcggc
aagtacctgtggctgctgctggacggctgcgataccgcgctggtggtgcacctgggcatg
agcgggcagatgctgctcggcgcggtgccgcgcgccgagcacgtccgcatctcggcactg
ctcgacgacggcaccgtgctgagcttcgccgaccaacgcaccttcggcggctggatgctc
gccgaccttctcgaggtggacggcagcatcctgccccggcccgtcgcgcacctggcgcgc
gacccgctcgatccccgcttcgacgccgccgcggtggtaaaagtgttgcggcgcaagcac
tccgaaatcaagcgacagctgctcgatcagcaggtggtgtccgggatcggcaacatctac
gccgacgaggcgctgtggcgggccaaggtgcacggcgcccggatcgccgccacgatgacc
ggcaggcagctgaccgccgtgctggacgccgccgccgaggtgatgcgcgacgcgctggcc
cagggcggaacctcgttcgattcgctgtacgtcaacgtcaacggcgaatccgggtacttc
gaccgatcgctggacgcctacggccgggagggcgaaagctgccggcgctgcggcgcggtg
atgcgccgggagaagttcatgaaccgctcgtcgttctactgcccgaaatgccaaccgcgc
ccgcggctttga

DBGET integrated database retrieval system