KEGG   Mycobacterium avium subsp. paratuberculosis MAP4: MAP4_1014Help
Entry
MAP4_1014         CDS       T02662                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
mao  Mycobacterium avium subsp. paratuberculosis MAP4
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:mao00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MAP4_1014
Enzymes [BR:mao01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     MAP4_1014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1081752..1083107
Genome map
AA seq 451 aa AA seqDB search
MTARSYCVVGGGISGLTAAYRLRVAAGDDAVITLLDPAPQLGGILRTEPVGGVPMDLGAE
AFVLRRPELPALLSEVNLTGRQRVSTGARPLIYSRGRLHPLPTGTVVGIPSSAASMARLV
DEATLARIDAEPRRPLHWRPGSDPAVADLVGDRFGEQVVSRSVDPLLSGVYAGSAATIGL
RAAAPTVAAALDRGAASLTDAVRRALPPATGAPVFGALDGGYRVLVDELVARARPRRVRA
AAARLEPAGPGWAVVDDAGARRHADAVILAVPAREVARLLAGIAPRSAAAAGRVVAASSV
VLALAVPGDTAFPDCSGVLVATGERLRAKAITLSSKKWGTRADVQLLRLSFGRFGDQVAA
RTPDEELRGWALADLAAVFGLDVRPVDVRVQRWLDAMPQYGPGHAELVGELRAGLPPTLA
VAGGYLDGIGVPACVGAAGRAVEALQAEVAP
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgacggcccgctcgtattgtgttgtgggcggcggtatttcagggctgacggcggcctac
cggctgcgggtggcggccggcgacgacgcggtgatcacgctgctcgacccggcgccgcag
ctcggcggcatcctgcgcaccgagccggtcggcggcgtgccgatggacctgggcgccgag
gcgttcgtgctacgccgccccgagctgcccgcgctgctgagtgaagtgaatctgactggc
cgccaacgcgtttcgaccggcgcacgcccgctgatctacagccggggacggctgcacccg
ctgcccaccggcacggtggtgggcatcccgtcgtcggcggcgtcgatggccagactggtc
gacgaggcgacgctggcccgcatcgacgccgaaccgcggcggccgctgcactggcgcccc
ggcagcgatcccgcggtggccgacctggtgggcgatcggttcggcgagcaggtggtgtcg
cggtcggtggatccgctgctgagcggggtgtacgccggctcggcggccaccattgggctg
cgcgcggccgcccccaccgtggcggcggccctggaccgcggcgccgccagcctgaccgac
gcggtccggcgcgccctgccgccggccaccggggcgccggtgttcggtgcgctggacggc
ggctaccgggtgctggtcgacgagctggtcgcgcgcgcccgcccgcggcgggtccgggcc
gcggcggcccggctggaacccgccgggccgggatgggccgtggtcgacgacgccggtgcc
cgccggcacgccgacgcggtgatcctggccgtgccggcgcgggaggtcgcgcggctgctg
gccgggatcgccccgcgcagcgccgccgccgccggccgcgtcgtcgccgcgtcgtcggtg
gtgctggcgctcgcggtgccgggcgacaccgcgtttcccgactgctccggcgtgctggtc
gccaccggcgagcggttgcgggccaaggccatcacgctgtcgtccaagaaatgggggacg
cgcgcggacgtgcagctgctgcggttgtcgttcggccggttcggcgaccaggtggccgcc
cgcacccccgacgaggagctgcgcggctgggcgctggccgacctggccgccgtgttcggg
ctggatgtccgcccggtggacgtgcgggtgcagcgctggctcgacgccatgccgcagtac
gggcccggccatgccgagctggtcggcgagctgcgcgcgggcctgccgccgacgctcgcg
gtggccggcggctacctggacggcatcggggtgcccgcctgcgtgggcgcggccgggcgc
gcggtcgaggcccttcaggcggaagtggcaccatag

DBGET integrated database retrieval system