KEGG   Mycobacterium avium subsp. paratuberculosis MAP4: MAP4_1529Help
Entry
MAP4_1529         CDS       T02662                                 

Definition
NAD-dependent glutamate dehydrogenase
Orthology
K15371  
glutamate dehydrogenase [EC:1.4.1.2]
Organism
mao  Mycobacterium avium subsp. paratuberculosis MAP4
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Taurine and hypotaurine metabolism
Nitrogen metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:mao00910]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mao00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mao00330]
Metabolism; Metabolism of other amino acids; Taurine and hypotaurine metabolism [PATH:mao00430]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1640583..1645433
Genome map
AA seq 1616 aa AA seqDB search
MTIDPRAQQDLKPWTTFTRQQDIPEWISKAYVESYRGPHSDESGGAEAGPIDLTVPTALV
TPAMLSAHYRLGLHRPDGESRVAVYPADDPAGFGPALQVVTDHGGMLMDSVTVLLHRLGV
PYTAIMTPVFDVHRSPDGDLLSLEPKPQGAPQYAGEAWIHVQLLPSVDSKGLTEAERLLP
KVLADVQQVASDASALIAVLDELAAAVEANRDNHFSAPDRDDVAALLRWLGNGNFLLLGY
QRCRVHDGLVSGDGSPGLGVLRTRTGSRPRLTDDDRLLVLAQSVVGSYLRYGAYPYAIAV
REYVDAAVIEHRFVGLFTVAAMNADVLEIPTISRRVREALAMADSDPIHPGQLLLDVIQT
VPRSELFTLSSERLLAMAKAVVDLGPQRNALLFLRADSLQYFVSCLVYLPRDRYTTAVRL
QIEDILVREFGGTRLEFTARVSESPWALMHFMVRLPTDDPAAKPVDVSEDNRVRIQGLLS
EAARTWTDRLVAAAAEGAVGHADAEYYADAFPEVYKQAISPADAIGHIAIIKELQDNSVK
LVFTEGEDGSAQLTWFLGGRTASLSQLLPMLQSMGVVVLEERPFTVTRSDGLPVWIYQFR
ISPHPTIELASTPDERDAMAERFADAVTAIWQGRLEVDRFNELVMRAGLRWQQVVLLRAY
AKYLRQANFPYSQSYIEAVLNEHPSTARSLVALFEALFDPHPDSSAGRDAQAAAAAVAAD
IDALVSLDTDRILRAFASLVQATLRTNYFVTREGSARARNVLAIKLDAQLIDELPLPRPK
YEIFVYSPRVEGVHLRFGPVARGGLRWSDRRDDFRTEILGLVKAQAVKNAVIVPVGAKGG
FVVKRPPLPSGDGAADRDATRAEGVACYQLFISGLLDVTDNVDHATGKVSPPPEVVRRDG
DDAYLVVAADKGTATFSDIANDVAKSYGFWLGDAFASGGSVGYDHKAMGITARGAWEAVK
RHFREMGVDTQTEDFTVVGIGDMSGDVFGNGMLLSKHIRLLAAFDHRHIFLDPNPDAAAS
WEERRRMFELPRSSWDDYDKSLISEGGGVYSREHKSIPVSPQVRDALGLDGSGGDVTEMT
PPNLIKAILQAPVDLLFNGGIGTYIKAESESDADVGDRANDPVRVNGSSVRAKVIGEGGN
LGVTALGRVEFDLSGGRINTDAMDNSAGVDCSDHEVNIKILIDSLVTAGKVKPQERKPLL
ESMTDEVAALVLTDNEDQNDLIGTSRANAPSLLPVHARQIQYLVDERGLNRELEALPSEK
EIQRRAEAGIGLTSPELCTLMAHVKLDLKEQMLQTELTEQDVFASRLPLYFPTPLRHRFT
PEIRAHQLRREIVATMLINELVDAAGISYAFRIVEDVGVSAVDAVRTYVATDAIFGVGEI
WRRIRAANLPVALSDRLTLDTRRLIDRAGRWLLNYRPQPLAVGAEINRFAAKVKALTPRM
SEWLRGDDKAIVEKEAAEFESQGAPRDLAYLVAAGLYRFSLLDIIDIGDINDIDAAEVAD
TYFALMDRLGTDGLLTAVSELPRNDRWHSLARLAIRDDIYASLRSLCFDVLAVGEPDESG
EEKIAEWEHLSASRVERARRTLIEIQESGAKDLATLSVAARQIRRMTRTSGRGSSS
NT seq 4851 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcgatcccagagctcagcaggatctcaagccgtggacgaccttcacccgacag
caggacatccccgagtggatctcgaaagcctatgtggagagctatcgcggtccgcatagc
gacgaatccgggggcgccgaggccgggcccatcgacctgacggtcccgacggcgctcgtc
accccggccatgctcagcgcgcactaccggctcgggctgcatcgccccgacggcgaaagc
cgggtcgccgtctacccggccgacgatcccgccgggttcgggccggcgctgcaggtcgtc
accgaccacggcggcatgctgatggactcggtcacggtgctgctgcaccgcctcggcgtg
ccctacacggccatcatgacgccggtgttcgacgtgcaccgcagtcccgacggcgacctg
ctcagcctcgaacccaagccgcagggcgccccgcaatacgccggcgaggcctggatccac
gtgcagctgctgccgtccgtcgacagcaagggcctcaccgaggcggagcggctgctgccc
aaggtgctggccgacgtccagcaggtggccagcgacgcctcggccctgatcgccgtgctc
gacgagctggccgccgcggtggaagccaaccgcgacaaccatttttcggcgccggaccgc
gacgacgtggccgcgctgctgcgctggctgggcaacggcaatttcctgctgctgggttat
cagcgctgccgggtgcacgacggcctggtctccggcgacggctcaccggggttgggcgtg
ctgcgcacccgcaccgggtcacggccccggctcaccgacgacgaccggctgctggtgttg
gcgcaatccgtggtgggcagctacctgcgctacggcgcctacccgtatgcgatcgcggtc
cgcgagtacgtcgacgccgcggtgatcgagcaccgcttcgtcgggctgttcaccgttgcc
gccatgaacgccgacgtgctggagattcccaccatctcccgccgcgtccgcgaggcgctg
gccatggccgacagcgacccgatccatcccggccagctgctgctcgacgtcatccaaacc
gtgccccgctcggaactgttcacgctgagctccgagcggctgctggcgatggccaaagcg
gtggtggacctcgggccgcaacgaaacgcgttgctgttcctgcgcgccgacagcctgcag
tacttcgtctcctgcctggtctacctgccccgcgaccgctacacgaccgcggtgcggctg
cagatcgaagacatcctggtccgcgaattcggcggcacccgactggaattcaccgcccgg
gtcagcgaatcaccttgggcgctcatgcatttcatggttcgcctgcccaccgacgatccc
gccgccaagcccgtggacgtctccgaggacaaccgggtccgcatccagggcctgctgagc
gaagcggcccgcacctggaccgaccggctggtcgcggccgccgccgagggcgcggtgggg
cacgccgacgcggagtactacgcggacgctttccccgaggtctacaagcaagccatcagc
ccggccgatgcgatcggtcacatcgccatcatcaaagagctgcaagacaattcggtcaag
ctggtgttcaccgagggcgaggacggatcggcgcagctgacctggttcctgggcgggcgc
accgcctcgctgagccagctgctgccgatgctgcaaagcatgggtgtggtggtgctcgaa
gagcggccgttcaccgtcacccgctccgacgggctgccggtgtggatctaccagttcagg
atctcaccgcacccgaccatcgagctggcgtccaccccggacgagcgcgacgcgatggcc
gagcgattcgccgacgccgtcaccgcgatctggcagggccgcctcgaggtcgaccgcttc
aacgaactggtgatgcgcgccggcctgcgctggcagcaggtggtgctgctgcgcgcctac
gcaaagtacttgcgccaggccaactttccctacagccagtcctacatcgaggcggtgctc
aacgagcatccgtccaccgcccgctccttggtggcgctgttcgaggcgctgttcgacccc
caccccgactcctcggcgggtcgcgacgcgcaggcggccgccgcggcggtggccgccgac
atcgacgcgctggtcagcctggacactgaccgcatcctgcgggcgttcgcgtcgctggtg
caggccacgctgcggaccaattactttgtcacccgcgagggttcggcccgtgcgcgcaac
gtgttggcgatcaagctggacgcccagctgatcgacgagctgcccctgccgcgccccaag
tacgagatcttcgtctactcgccccgggtcgagggcgtgcacctacggttcgggccggtg
gcccgcggcgggctgcgctggtcggaccgccgcgacgacttccgcaccgaaatcctgggc
ctggtcaaggcgcaagccgtcaagaacgccgtcatcgtgccggtcggggccaagggcggc
ttcgtcgtcaagcggccgccgctgcccagcggggacggcgccgccgaccgcgacgccacc
cgcgccgagggggtggcctgctatcagctgttcatctcgggcctgctcgacgtcaccgac
aatgtcgaccacgcgaccggaaaggtcagcccgccaccggaagtggtgcgccgcgacggc
gacgacgcctacctggtggtggcggccgacaagggcaccgccaccttctccgacatcgcc
aacgacgtcgccaagtcctacggattctggctgggtgacgcgttcgcctccggcgggtcg
gtcggctacgaccacaaggccatgggcatcaccgcccggggcgcctgggaggcggtcaaa
cggcacttccgggagatgggcgtcgacacccagaccgaggacttcaccgtggtgggaatc
ggcgacatgagcggcgacgtgttcggcaacggcatgctgctgtccaagcacatccggctg
ctggccgccttcgaccaccgacacatcttcctcgacccgaaccccgacgccgcggcgtcc
tgggaggaacgccgccgcatgttcgagctgccccggtccagctgggatgactacgacaag
tccctgatcagcgagggcggcggggtgtatagccgcgagcacaaatccattccggtcagc
ccccaggtccgcgacgcgctgggcttggacggctcaggcggcgacgtcaccgagatgact
ccgcccaacctgatcaaggcgatcctgcaggcgccggtggacctgctgttcaacggcggc
atcggcacctacatcaaggccgagtccgagtcggacgccgacgtcggcgaccgcgccaac
gatccggtgcgggtcaacggatcctcggtgcgcgccaaggtgatcggcgaaggcggcaac
ctcggggtgacggcgctgggccgcgtcgagttcgacctgtccggcggccggatcaacacc
gacgcgatggacaactccgccggcgtggactgctccgaccacgaggtcaacatcaagatc
ctgatcgactcgctggtcaccgcgggcaaggtcaagccgcaggagcgcaaaccgctgctg
gagtcgatgaccgacgaggtcgccgcgctggtgctcaccgacaacgaggaccagaacgac
ctgatcggcaccagccgggccaacgcgcccagcctgctgccggtgcacgcccggcagatc
cagtacctggtcgacgagcgcggcctcaaccgcgagctggaagcgctgccgtcggagaag
gagattcagcgccgcgccgaggccgggatcggcctcacctcacccgaactgtgcacgctg
atggcgcacgtgaaactggacctcaaagaacagatgctgcagaccgagctcaccgagcag
gatgtgttcgcgtcccggttgccgctgtacttcccgacgccgctgcggcaccggttcacc
ccggagatccgcgcgcatcagctgcgccgcgagatcgtggccaccatgctgatcaacgag
ctggtggacgccgccggcatcagctacgccttccggatcgtcgaggacgtcggcgtatcg
gcggtggacgcggtgcgcacctacgtcgccaccgatgccatcttcggtgtgggggagatc
tggcgccgcatccgcgccgcgaatctgcctgtggcgctgtcggatcggctcaccctggat
acccggcggctgatcgaccgggccggccgctggctgctcaactaccgtccccagccgttg
gcggtgggcgccgagatcaaccgattcgccgccaaggtcaaggcgctgacaccgcgcatg
tcggaatggctgcgcggggacgacaaggccatcgtcgaaaaggaagccgccgagttcgag
tcccagggcgccccccgtgacctggcctacctggtggccgccgggctctaccggttcagc
ctgctcgacatcatcgacatcggcgacatcaacgacatcgacgccgccgaggtcgccgac
acctatttcgccctgatggaccggctcggcaccgacggcctgctgaccgcggtgtccgag
ctgccgcgcaacgaccggtggcactctttggcgcgcttggcgattcgcgacgacatctac
gcctcgctgcgctcgctgtgcttcgacgtgctggcggtgggcgagcccgacgagagcggc
gaagagaagatcgccgagtgggaacacctgtccgcctcccgggtcgagcgggcccgccgc
acactgatcgagatccaggaaagcggggccaaggatctcgcgacgctgtccgtcgccgcg
cgacaaatccgtcgcatgacccgcaccagcggaagaggttcatcgagttga

DBGET integrated database retrieval system