KEGG   Mycobacterium avium subsp. paratuberculosis MAP4: MAP4_1561Help
Entry
MAP4_1561         CDS       T02662                                 

Definition
glutamate 5-kinase protein proB
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
mao  Mycobacterium avium subsp. paratuberculosis MAP4
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mao01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mao00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1682003..1683106
Genome map
AA seq 367 aa AA seqDB search
MTAHRDAIRTARSMVVKVGTNALTTPAGVFDAGRLAGLADAIEARMKAGTDVVIVSSGAI
AAGIEPLGLSRRPRDLATKQAAASVGQVALVNSWSAAFARYGRTVGQVLLSAHDISMRAQ
HTNAQRTLDRLRALHAVAIVNENDTVATNEIRFGDNDRLSALVAHLVGAEALVLLSDIDG
LYDSDPRKTKGAKFIPEVTGAEDLAGVVAGPGSDLGTGGMTSKMSSALLAADAGVPVLLA
AAADAASALTDASVGTVFAARPVRMSARRFWVRYAAEAAGALTLDEGAVRAVVHQRRSLL
PAGITAVSGRFYAGDVVELRGPDAVPVARGVVAYDTTELATMMGRSTSELPGELRRPAVH
ADDLVAV
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcccaccgcgacgccatccgcacggcgcgcagcatggtggtcaaggtgggcacc
aacgcgttgaccaccccggccggggtgttcgacgccggccggctggccgggctcgccgac
gccatcgaggcgcggatgaaggccggcaccgacgtcgtcatcgtctcgtcgggtgccatc
gccgcgggcatcgagccgctcggattgtcccgtcgccccagggatctggcgaccaagcag
gccgcggccagcgtcggtcaggtggcactggtgaattcctggagcgcggcgttcgcccgc
tacggccgcaccgtcgggcaggtgctgctgagcgcgcacgacatctcgatgcgcgcccag
cacaccaacgcccagcgcaccctggatcggctgcgcgccctgcatgcggtggcgatcgtc
aacgagaacgacaccgtggccaccaacgagatccggttcggcgacaacgaccggctctcg
gcgctggtggcccacctggtcggcgccgaggcgctggtcttgctgtccgacatcgacggc
ctttacgactcggacccgcgaaagaccaagggagccaagttcattccggaggtgacgggc
gcggaggatctggccggcgtggtcgccggcccgggcagcgacctgggcaccggcggcatg
acgtcgaagatgtcctcggcgctgctggccgccgacgccggggtgcccgtgctgctggcc
gccgcggccgacgccgccagcgcgctcaccgacgcttcggtcggcacggtgttcgccgcc
cggccggtgcggatgtcggcccggcggttctgggtgcgctacgccgccgaggcggccggc
gcgctgaccctggacgagggcgcggtgcgcgccgtggtgcatcagcgccgctcgctgctg
cccgcgggcatcaccgcggtgtccggccggttctacgccggcgacgtcgtggaactgcgc
gggccggacgcggtgccggtggcccgcggcgtggtggcctacgacaccaccgaactggcg
accatgatggggcgctcgaccagtgagctgcccggcgagctgcgcaggcccgcggtgcac
gccgacgacctggtggcggtgtga

DBGET integrated database retrieval system