KEGG   Mycobacterium avium subsp. paratuberculosis MAP4: MAP4_1561Help
Entry
MAP4_1561         CDS       T02662                                 

Definition
glutamate 5-kinase protein proB
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
mao  Mycobacterium avium subsp. paratuberculosis MAP4
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mao00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MAP4_1561
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MAP4_1561
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    MAP4_1561
Enzymes [BR:mao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     MAP4_1561
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1682003..1683106
Genome map
AA seq 367 aa AA seqDB search
MTAHRDAIRTARSMVVKVGTNALTTPAGVFDAGRLAGLADAIEARMKAGTDVVIVSSGAI
AAGIEPLGLSRRPRDLATKQAAASVGQVALVNSWSAAFARYGRTVGQVLLSAHDISMRAQ
HTNAQRTLDRLRALHAVAIVNENDTVATNEIRFGDNDRLSALVAHLVGAEALVLLSDIDG
LYDSDPRKTKGAKFIPEVTGAEDLAGVVAGPGSDLGTGGMTSKMSSALLAADAGVPVLLA
AAADAASALTDASVGTVFAARPVRMSARRFWVRYAAEAAGALTLDEGAVRAVVHQRRSLL
PAGITAVSGRFYAGDVVELRGPDAVPVARGVVAYDTTELATMMGRSTSELPGELRRPAVH
ADDLVAV
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcccaccgcgacgccatccgcacggcgcgcagcatggtggtcaaggtgggcacc
aacgcgttgaccaccccggccggggtgttcgacgccggccggctggccgggctcgccgac
gccatcgaggcgcggatgaaggccggcaccgacgtcgtcatcgtctcgtcgggtgccatc
gccgcgggcatcgagccgctcggattgtcccgtcgccccagggatctggcgaccaagcag
gccgcggccagcgtcggtcaggtggcactggtgaattcctggagcgcggcgttcgcccgc
tacggccgcaccgtcgggcaggtgctgctgagcgcgcacgacatctcgatgcgcgcccag
cacaccaacgcccagcgcaccctggatcggctgcgcgccctgcatgcggtggcgatcgtc
aacgagaacgacaccgtggccaccaacgagatccggttcggcgacaacgaccggctctcg
gcgctggtggcccacctggtcggcgccgaggcgctggtcttgctgtccgacatcgacggc
ctttacgactcggacccgcgaaagaccaagggagccaagttcattccggaggtgacgggc
gcggaggatctggccggcgtggtcgccggcccgggcagcgacctgggcaccggcggcatg
acgtcgaagatgtcctcggcgctgctggccgccgacgccggggtgcccgtgctgctggcc
gccgcggccgacgccgccagcgcgctcaccgacgcttcggtcggcacggtgttcgccgcc
cggccggtgcggatgtcggcccggcggttctgggtgcgctacgccgccgaggcggccggc
gcgctgaccctggacgagggcgcggtgcgcgccgtggtgcatcagcgccgctcgctgctg
cccgcgggcatcaccgcggtgtccggccggttctacgccggcgacgtcgtggaactgcgc
gggccggacgcggtgccggtggcccgcggcgtggtggcctacgacaccaccgaactggcg
accatgatggggcgctcgaccagtgagctgcccggcgagctgcgcaggcccgcggtgcac
gccgacgacctggtggcggtgtga

DBGET integrated database retrieval system