KEGG   Mycobacterium avium subsp. paratuberculosis MAP4: MAP4_1573Help
Entry
MAP4_1573         CDS       T02662                                 

Definition
Ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mao  Mycobacterium avium subsp. paratuberculosis MAP4
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mao00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MAP4_1573
Enzymes [BR:mao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     MAP4_1573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1694299..1695177)
Genome map
AA seq 292 aa AA seqDB search
MTDVCVVGSVNLDLSLAVDALPRPGETVLASSLRQAPGGKGGNQAVAAARAGARVQFVGA
VGDDAAAGQLRAHLQANGVGLDGAVEIPGPSGTAIVVVDANAENTIVVAPGANGRFTLND
ERARAVLAGCDVMLTQLEIPVATAVAAARHARSGGAVVVVNASPAGRDPDSLSELAAAAD
VVITNEEEASEWPWRPRHLVVTLGSHGARYVGADGEYSVPSPDVDAVDTTGAGDVFAGVL
AANWPLEPGSPDQRRLALRRACAAGALATLVPGAGDCAPRAEEIERALRGKS
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgacagacgtctgtgtggtgggcagtgtgaacctcgatctgtcgctggccgtcgacgcg
ctgccgcggcccggcgagacggtgctggcgtcgtcgttgcggcaggcccccggcggcaag
gggggcaaccaggcggtggcggcggcgcgggcgggcgcgcgggtgcagttcgtcggcgcg
gtcggcgacgacgcggccgccgggcagttgcgggcgcacctgcaggccaacggggtcggg
ctggacggggccgtcgagatccccgggcccagcggcaccgcgatcgtggtcgtcgacgcc
aacgccgagaacaccatcgtggtcgccccgggcgccaacgggcggttcacgctgaacgac
gagcgtgcccgcgcggtgctcgcgggctgcgacgtgatgctcacccagctcgagattcct
gtcgccaccgcggtcgcggcggcgcggcacgcccggtccggcggagcggtggtcgtggtg
aacgcgtcgccggcaggccgggaccccgactcgttgagcgagctggccgccgccgccgac
gtggtgatcaccaacgaggaggaggccagcgaatggccttggcggccaaggcacttggtg
gtcaccctgggatcgcacggtgcccgttacgtcggcgccgacggcgagtactcggtgccc
tcccccgacgtcgatgcggtggacaccacaggtgccggcgacgtgttcgccggggtgctg
gcggcgaactggccactcgagcccggttcgccggatcagcggcggctggcgttgcgacgg
gcctgcgccgcgggtgcgctggccaccctggtgcccggggccggggattgcgcgccgcgg
gccgaggaaatcgaaagggccttgcgtggtaagtcttag

DBGET integrated database retrieval system