KEGG   Mycobacterium avium subsp. paratuberculosis MAP4: MAP4_2106Help
Entry
MAP4_2106         CDS       T02662                                 

Definition
Catalase
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
mao  Mycobacterium avium subsp. paratuberculosis MAP4
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:mao00630]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:mao00380]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2323000..2324028
Genome map
AA seq 342 aa AA seqDB search
MSAVAGFAAVDVGGFAYAGGWLRPDSPLTPPRFADRFEHVYGRHDGFRRNHAKGLSATGS
FTSTGAGAAICRAAVFREGTVPVVGRFSLGGGLPDQADKPETVRGLGLLFDAGGQQWRTA
MVNVPVFTDSTPEGFYERLLATKPVPSTGKPDPQKMAAFLDRHPETAAAMKIIKQSPPSA
GFADTTFYGLNAFLFTNSAGATVPVRWSVVPHDGGVAGAPGPTRGKDFLFDDLIRTLAQR
PLKWRLILTLGEPGDPTHDATKPWPQSRRTVDAGTVTITAVHTEEEGNARDINFDPLVLP
DGITPSDDPLPAARSAVYARSFTRRAEEPKSHSEVNVTRVLP
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcggttgccggattcgccgcggtggacgtcggcgggttcgcctacgcgggcggg
tggctgcgccccgactccccgctcacgccgccgcggttcgccgatcgcttcgagcacgtc
tacggccgccacgacgggttccggcgaaatcacgccaagggcctcagcgctaccgggtcg
ttcacgagcaccggcgcgggcgcggcgatctgccgggcggcggtcttccgggagggcacc
gtcccggtcgtcggccggttttcgctaggcgggggcctgccggaccaggcggacaagccc
gagactgtccgcggcctcgggctgttgttcgacgcgggtggccagcaatggcgcaccgcc
atggtcaacgtgccggtcttcaccgatagcacgccggaggggttttacgagcgcctgctc
gcgaccaaacccgtgccctcaaccgggaagcccgacccgcagaagatggccgcgtttctc
gatcgtcaccccgagacggccgcggcgatgaaaatcatcaagcagtcgccgccgagtgcc
gggtttgcagacaccacgttctacgggctcaacgccttcttgttcaccaacagcgccggc
gccaccgttccggtgcggtggtcggtagttccgcatgacggcggcgtggccggcgcaccg
gggccgacgcgtggcaaggactttcttttcgacgacctgatccgcacgctggcccagcgg
ccgctgaagtggcggctgattctgacgctgggtgagcccggcgatcccacccacgatgcc
accaagccgtggccgcaatcgcggcgcaccgtcgacgccggcaccgtcaccatcaccgcg
gtgcacaccgaggaagagggcaacgcgcgcgacatcaacttcgacccgctggtgctgccc
gacggcatcacgccgtccgacgatccgttgcccgcggcgaggtcggccgtgtacgcgcgg
tccttcacccgtcgcgccgaggagcccaagtcgcacagcgaggtcaacgtgacgcgggtg
ctgccatga

DBGET integrated database retrieval system