KEGG   Mycobacterium avium subsp. paratuberculosis MAP4: MAP4_2341Help
Entry
MAP4_2341         CDS       T02662                                 

Definition
4-alpha-glucanotransferase (amylomaltase)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mao  Mycobacterium avium subsp. paratuberculosis MAP4
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mao00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MAP4_2341
Enzymes [BR:mao01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     MAP4_2341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2565863..2568004
Genome map
AA seq 713 aa AA seqDB search
MTELAPSLIELARRYGIATDYEDWTGRRVRVPETTLTAVLAALGVAAGTEQERNDALTAK
LRAYWARRLPATIVGRTGEQIRFWGHVTHGDPAEVWVRLEDGTVRDGVEQVDNFTPPFDL
DGRWVGEASFVLPTDLPLGYHRVWLRSGGSEASAALIVTPDWLGLPERLGARRAWGLAVQ
LYSVRSRQSWGVGDLTDLTDLAVWSAFRHGADYLLVNPLHAAGFSGPANRMEPSPYLPTS
RRFVNPIYLHVEAIPEFAELTKRSRVRRLRADVQTHAAGLDAVDRDSSWAAKRTALQWLH
QQPRSAGRQLCYAAFRDREGRALDDFATWCALAEEYGPDWHSWPETLQHPDAPGVADFVE
KHSEAVDFHRWLQWQLDEQLAAAQSQAIRAGMSLGIMHDLAVGVHPNGADAWALQDVMAL
GVTAGAPPDEFNQLGQDWSQPPWRPDRLDEHEYRPFRALIRAVLRHAGGVRIDHIIGLFR
LWWIPRGSAPTEGTYVRYDHEAMIGIVALEAHRAGAVVVGEDLGTVEPWVRDYLLLRGLL
GTSILWFELDRDGNGGPLPAERWREYCLSSVTTHDLPPTAGYLAADHVRLRDSLGLLTRP
VADELESDRADLAAWMAELRRVGLLADGETDSEQVILALYRYLGRTPSRLLGVALTDAVG
DRRTQNQPGTTDEYPNWRVPLTGPDGRPVLLEDVFTDRRAAALAEAVRAAIAP
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgacagaactcgcgccgtcgctgatcgaactcgcccgcagatacggcatcgcgacggat
tacgaggactggaccggccgccgggtgcgggtgcccgagaccaccctcacggcggtgctg
gccgcgctcggcgtggccgccggcaccgagcaggaacgcaacgacgcgctgaccgccaag
ctgcgcgcgtactgggcgcgccggttgcccgcgaccatcgtcgggcggaccggtgagcag
atccggttctgggggcacgtcacccacggcgatcccgccgaggtgtgggtgcggctggag
gacggcaccgtgcgcgacggcgtcgaacaagtcgacaacttcaccccgccgttcgacctg
gacggccgctgggtcggcgaggcgagcttcgtgctgcccaccgacctgccgctcggctat
caccgggtgtggctgcgctcgggcggatcggaggccagcgccgcgctgatcgtcacgccg
gattggctcggcctgccggaacgcctgggcgcccggcgcgcctggggcctggccgttcag
ctctacagcgtgcggtcccggcagtcctggggcgtcggcgatctcaccgatctcaccgac
ctcgcggtgtggtcggccttccgtcacggcgccgactatctgttggtcaatcccctgcac
gcggccgggttctccggccccgccaaccggatggagccctcgccctacctgccgacctcg
cggcgcttcgtcaatccgatttatcttcacgtcgaggcgatcccggagttcgccgaactg
accaagcgcagccgggtccggcggctgcgcgcggacgtgcaaacgcacgccgccggcctg
gacgccgtcgaccgggacagctcctgggcggccaagcgcacggcgctgcagtggctgcac
caacagccccgctcggcgggccggcaactgtgttacgccgccttccgcgaccgcgagggc
cgggcgctcgacgacttcgccacctggtgcgcgctggccgaagaatacggcccggactgg
cattcctggcccgagacgctccagcacccggacgcccccggggtcgccgatttcgtcgaa
aagcattcggaggcagtcgatttccatcgctggctgcagtggcagctggacgagcagctg
gccgccgcgcagtcccaggcgatccgggccgggatgtcgctgggcatcatgcacgacctg
gccgtcggtgtgcatcccaacggcgccgacgcctgggcgctgcaggatgtgatggcgctg
ggggtgaccgccggcgcgccgccggacgagttcaaccagctcggccaggactggtcgcag
ccgccgtggcgaccggaccggctcgacgagcacgagtaccggcccttccgcgccctgatc
cgcgcggtgctgcgacatgccggcggggtgcgcatcgaccacatcatcgggctgttccgg
ctgtggtggatcccgcgcggcagcgccccgaccgagggcacctacgtgcgctacgaccac
gaggccatgatcggcatcgtcgcgctggaggcgcatcgggccggggcggtggtggtcggc
gaggacctgggcactgtcgagccgtgggtgcgcgactacctgttgttgcgcggcctgctg
gggacctcgatcctgtggttcgagttggaccgcgacggtaacggcggcccgctgccggcc
gagcggtggcgggagtactgcctgtcctcggtcaccacccacgacctgccgccgaccgcc
ggctatctggccgccgaccatgtccggctgcgcgattcgctgggcctgctgacccggccg
gtggccgacgagctggagtccgaccgcgccgacctggcggcgtggatggccgagctgcgc
cgggtggggctgctcgcggacggcgaaaccgactcggagcaagtcattttggcgctctac
cgctatctgggccggacgccgtcgcggctgctgggtgtggcgctgaccgacgccgtgggc
gaccgccgcacccagaaccagcccggcaccaccgacgagtaccccaactggcgcgttccg
ctgaccggtccggacgggcggccggtgctgctggaagacgtgttcaccgatcgccgggcc
gccgccctggccgaggcggtgcgcgccgccatcgcgccgtga

DBGET integrated database retrieval system