KEGG   Mycobacterium avium subsp. paratuberculosis MAP4: MAP4_2436Help
Entry
MAP4_2436         CDS       T02662                                 

Definition
catechol-o-methyltransferase
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
mao  Mycobacterium avium subsp. paratuberculosis MAP4
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mao00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    MAP4_2436
Enzymes [BR:mao01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     MAP4_2436
Exosome [BR:mao04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   MAP4_2436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2686100..2686804
Genome map
AA seq 234 aa AA seqDB search
MAAGVQNITTTGQIGDGREAAAVEYVLRNARAGDIDDVLATIDRFAYQKSMLINVGDEKG
LILDAAVRRADPDVALELGTYCGYGALRIARAAPGARVFSVELADANAANARRIWAHAGV
ADRVTCVVGTIGDGGRTLDVLANEHGFAAGTLDFVFLDHDKDAYLADLKSIMDRGWLHPG
SIVVADNIRWPGSPKYREYMHVQQGKRFDTVEHKTHAEYQTMLSDLMLESEYLG
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggcggccggggtgcagaacatcaccaccaccggccagatcggtgacggacgggaagcg
gccgccgtcgagtacgtgctgcgcaacgcgcgggccggcgacatcgacgacgtgctggcc
accatcgacaggttcgcctaccagaaatcgatgctgatcaatgtcggcgacgagaagggg
ctgatcctcgacgccgcggtgcgccgcgccgacccggacgtggcgctggagctgggcacc
tactgcggctacggcgcgttgcggatcgcccgggccgccccgggcgcccgggtgttctcg
gtcgaactggccgacgccaacgccgccaacgcccgccggatctgggcgcacgccggcgtc
gccgaccgggtgacctgcgtggtgggcaccatcggcgacggcgggcgcaccctggacgtc
ctggccaacgagcacggattcgctgccggcacactggatttcgtgtttctcgatcacgac
aaggacgcctacctggccgacctgaagagcatcatggaccggggctggctgcatccgggc
tcgatcgtcgtcgccgacaacatccgctggccgggctcgccgaagtaccgcgagtacatg
catgtccagcagggcaagcggttcgacaccgtcgagcacaagacgcatgccgagtaccag
accatgctctccgacctgatgctggagtccgaatacctgggctga

DBGET integrated database retrieval system