KEGG   Mycobacterium avium subsp. paratuberculosis MAP4: MAP4_2798Help
Entry
MAP4_2798         CDS       T02662                                 

Definition
class II aldolaseadducin domain-containing protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mao  Mycobacterium avium subsp. paratuberculosis MAP4
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mao00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MAP4_2798
Enzymes [BR:mao01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     MAP4_2798
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3099007..3099804)
Genome map
AA seq 265 aa AA seqDB search
MASTFTDSKSELMRRAAEQLTALQGRDAAEPPLTTRQKLALTCRALFDAGHDSGLAGQIT
ARAEADGTYYTQRLGLGFDEITDGNLLLVDEDLNVLEGDGMANPANRFHSWIYRARPDVQ
CIVHTHAFHVAALSMLEVPLVVSHMDTTPLYDDCAFLADWPGVPVGNEEGEIITAALGDK
KAVLLAHHGHVIAGASIEEACSLGILIERAAKLQLAAMAAGTVKQLPEELAREAHDWTLS
PQRSRANFAYYARRALARHPDALTS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggccagcacgttcaccgattcgaaatcggaattgatgcgccgggctgccgagcagttg
acggcgttgcagggccgggacgccgccgaaccgccgttgaccacccgccagaagctggcc
ctgacctgccgggcgctgttcgacgccgggcacgactcggggctggccgggcagatcacc
gcccgcgccgaggccgacggcacctactacacgcagcggctcggcctgggcttcgacgag
atcaccgacggcaatctgctgctggtcgacgaggacctcaatgtcctcgagggtgacgga
atggccaaccccgccaaccgctttcacagctggatctatcgcgcccgccccgacgtgcag
tgcatcgtgcacacccacgcgttccacgtggcagccctgtccatgctggaggtcccgctg
gtggtatcccacatggacaccaccccgctgtacgacgactgcgcgtttctggcggactgg
ccgggcgtgcccgtcggcaacgaggagggggagatcatcaccgccgcgctgggcgacaag
aaggcggtgctgctggcccaccacggccacgtcatcgccggcgccagcatcgaggaggcg
tgctcgttgggaatcctcatcgagcgcgccgccaagctgcagctggccgcgatggctgcc
ggcaccgtcaagcagctgcccgaggagctggcccgcgaggcccacgactggacgctgtca
ccgcagcgcagccgggccaacttcgcctactacgcccgccgggccctggcccgccatccc
gacgcgctgaccagctga

DBGET integrated database retrieval system