KEGG   Mycobacterium avium subsp. paratuberculosis MAP4: MAP4_3335Help
Entry
MAP4_3335         CDS       T02662                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
mao  Mycobacterium avium subsp. paratuberculosis MAP4
Pathway
mao00360  Phenylalanine metabolism
mao00362  Benzoate degradation
mao00620  Pyruvate metabolism
mao00621  Dioxin degradation
mao00622  Xylene degradation
mao00650  Butanoate metabolism
mao01100  Metabolic pathways
mao01120  Microbial metabolism in diverse environments
mao01220  Degradation of aromatic compounds
Module
mao_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mao00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MAP4_3335
   00650 Butanoate metabolism
    MAP4_3335
  Amino acid metabolism
   00360 Phenylalanine metabolism
    MAP4_3335
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MAP4_3335
   00622 Xylene degradation
    MAP4_3335
   00621 Dioxin degradation
    MAP4_3335
Enzymes [BR:mao01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     MAP4_3335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AGL38203
Position
complement(3649847..3650764)
Genome map
AA seq 305 aa AA seqDB search
MPTKAKVAIVGSGNISTDLLYKLLRSDWLEPRWMVGIDPQSEGLARARKLGLETTHEGVD
WLLAQPEKPDLVFEATSAYVHRDAAPKYEAAGIRAIDLTPAAVGPAVIPPANLRQHLDAP
NVNMITCGGQATIPIVFAVSRVVEVPYAEIVASVASVSAGPGTRANIDEFTKTTSRGVET
IGGAKRGKAIIILNPADPPMIMRDTIFCAIPEDADRDAIAQSIHDVVKEVQTYVPGYRLL
NEPQFDEPSLNSGGQAVVTTFVEVEGAGDYLPPYAGNLDIMTAAATKVGEEIAKETLATT
AGGAQ
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgccgactaaagcaaaagtggcgattgtcgggtcggggaacatcagcacggacctgctc
tacaagctgctgcgatccgactggctggaaccacgctggatggtcggcatcgacccgcag
agcgagggcctggcccgggcccgcaagctgggcttggagaccacccacgagggggtcgac
tggctgctggcgcagccggagaaacccgacctggtcttcgaggcgaccagcgcttacgtg
caccgcgacgccgcccccaagtacgaggccgccggcatccgggccatcgacctgacgccc
gccgcggtgggcccggccgtcatcccgccggcgaacctgcgccagcacctggacgcgccg
aacgtcaacatgatcacctgcggcgggcaggccacgatcccgatcgtcttcgccgtcagc
cgcgtcgtcgaggtgccctacgccgagatcgtcgcgtcggtggcgagcgtgtcggcgggc
ccgggcacccgtgccaacatcgacgagttcaccaagaccaccagccggggcgtggagacc
atcggcggcgccaagcggggcaaggcgatcatcatcctcaacccggccgacccgccgatg
atcatgcgcgacaccatcttctgcgctatccccgaggacgccgaccgggacgcgatcgca
cagtcgattcacgacgtcgtcaaagaggtgcagacctacgtgcccggctaccggctgctc
aacgagccgcagttcgacgagccgtcgctcaactccggtggccaggccgtggtcaccacg
ttcgtcgaggtcgagggcgccggcgattatctgcccccgtacgcgggcaacctggacatc
atgaccgccgcggccaccaaggtcggcgaggagatcgccaaggagacgctggccacgacg
gcgggaggagcgcaatga

DBGET integrated database retrieval system