KEGG   Mycobacterium avium subsp. paratuberculosis MAP4: MAP4_3591Help
Entry
MAP4_3591         CDS       T02662                                 

Definition
cellulase celA1
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mao  Mycobacterium avium subsp. paratuberculosis MAP4
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mao00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3911017..3912006)
Genome map
AA seq 329 aa AA seqDB search
MTFSAAGAVARWIVPLFTVAALVGIGPVAEPAPAVRLAADGNPLAGAPFYVNPNSAAMRA
AQSADPPSPELTTIANTPQAYWIVPGGSAATVGKYVGDANAAGAIPVLAIYGIPHRDCGS
FAAGGMATADDYRGWIDGIAAGVGTSRVAIVVEPDALAMADCLSGDQRQERYELVRYAVD
TLTRNPNAAVYVDAGHLRWHSPEDMAARLNQAGVAHARGFSVNTANFYTTEDEIGYGEAI
SGLTNGAHYVIDTSRNGAGPAPDSELNWCNPSGRALGTPPTAATAGAHADAYLWIKRPGE
SDGSCGKGDPPAGNFVNQYAIDLVHNVGH
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
gtgacattctcagctgccggcgcggtcgcgcggtggatcgtccctctgttcacggttgcg
gccctggtcggcataggcccggtagccgaaccggcgccggcagtgcggttggccgccgac
ggcaatccgttggccggggcgccgttctacgtcaacccgaactcggcggccatgcgcgcc
gcgcagagcgccgatccgccgagtcccgagttgaccaccatcgccaacacgccgcaggcg
tactggatcgtgccgggcggctcggcggcgacggtcgggaagtacgtcggcgacgcgaac
gctgccggcgccatcccggttttggcgatttatggaatcccgcaccgcgattgcggcagc
ttcgccgcgggcggcatggcgacggccgacgactatcgcggctggatcgacggcatcgcg
gccggtgtgggtacctcgagggtggcgatcgtcgtcgaacccgatgcgctcgcgatggcc
gactgcctgtcgggcgatcagcgccaggaacgctacgagctggtccgctacgccgtcgac
acactgacccgcaaccccaacgcggccgtctacgtcgacgccgggcacctgcgttggcac
agtcccgaggacatggccgcccggctcaaccaggccggcgtcgcacacgcgcgaggattc
agcgtcaacaccgcgaacttttacaccaccgaggacgaaatcggttacggcgaagccatt
tccgggctcaccaatggtgcgcactacgtgatcgacacgtcgcgcaacggagccgggccg
gcgcccgactccgagctcaactggtgcaaccccagcggccgcgcgctgggcaccccgccc
accgcggccaccgcaggcgcccacgccgacgcctacctgtggatcaagcgtcccggcgaa
tccgacggatcctgcggcaagggtgatccgcccgccggcaacttcgtcaaccaatacgcc
atcgatctggtccacaacgtcggccactag

DBGET integrated database retrieval system