KEGG   Mycobacterium avium subsp. paratuberculosis MAP4: MAP4_3943Help
Entry
MAP4_3943         CDS       T02662                                 

Definition
aspartate aminotransferase AspC
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
mao  Mycobacterium avium subsp. paratuberculosis MAP4
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:mao01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mao01230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mao00250]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine biosynthesis [PATH:mao00290]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4280650..4281942)
Genome map
AA seq 430 aa AA seqDB search
MDSDGTIGGVTTHQLPVHSSAHHRQQRTFAQSSKLQDVLYEIRGPVHQHAARLEAEGHRI
LKLNIGNPAPFGFEAPDVIMRDMIQALPYAQGYSDSQGILPARRAVVTRYELVDGFPRFD
VDDVYLGNGVSELITMTLQALLDNGDEVLIPSPDYPLWTASTSLAGGTPVHYLCDETQGW
QPDIADLESKITERTKALVVINPNNPTGAVYSGEILSQMVDLARKHELLLLADEIYDKIL
YDDAKHINVASLAPDMLCLTFNGLSKAYRVAGYRAGWLAITGPKDHAGSFIEGINLLANM
RLCPNVPAQHAIQVALGGHQSIEDLVLPGGRLLEQRDVAWSKLNEIPGVSCVKPAGALYA
FPRLDPEVYDITDDEQLVLDLLLQEKILVTHGTGFNWPAPDHLRIVTLPWARDLAAAIER
LGNFLVGYRQ
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
gtggacagtgatggcaccattggtggtgtgacaacccaccagctgcctgtgcactcgtcc
gcgcaccatcgccagcagcgtactttcgcccagtcgtccaagctccaggacgtcctgtac
gagatccgcggcccggtacatcagcacgcggcgcggctggaggccgagggacaccgcatc
ctcaagctcaacatcggcaacccggcgccgttcggcttcgaggcgcccgacgtcatcatg
cgcgacatgatccaggccctgccgtacgcccagggctactccgactcgcagggcatcctg
cccgcgcgccgggcggtggtcacccgctacgagttggtcgacgggttcccccgcttcgac
gtcgacgatgtctacctgggcaacggcgtgtccgaactgatcacgatgacgctgcaggcg
ctgctcgacaacggcgacgaggtgctgatcccgtcgccggactacccgctgtggacggcg
tcgacctcgctggccggcggcacccccgtgcactacctgtgcgacgagacgcagggctgg
cagcccgacatcgccgatctggaatccaagatcaccgagcgcaccaaggcgctggtggtg
atcaacccgaacaacccgaccggcgcggtgtacagcggcgaaatcctgagccagatggtc
gatctggcgcgcaagcacgagctgctgctgctggccgacgagatctacgacaagatcctc
tacgacgacgccaagcacatcaacgtggcgtcgctggcgccggacatgctgtgcctgacc
ttcaacggcctgtcgaaggcgtaccgggtggccggctaccgggccggctggctggcgatc
accggacccaaggaccacgccggcagcttcatcgagggcatcaacctgctggccaacatg
cggctgtgcccgaacgtcccggcgcagcatgcgatccaggtggccctgggcggccaccag
agcatcgaggacctggtgctgccgggcgggcggctgctcgagcagcgcgacgtggcgtgg
agcaagctcaacgagatccccggggtgtcctgcgtcaaacccgccggcgccttgtacgcg
tttccccggctggaccccgaggtctacgacatcaccgacgacgagcagctggtgctcgac
ctgctgctgcaggagaagatcctggtcacccacggcaccggcttcaactggccggcgccg
gatcacctgcgcatcgtgacgctgccgtgggcgcgggacctggccgccgcgatcgagcgg
ctgggcaacttcctggtcggctatcgacagtaa

DBGET integrated database retrieval system