KEGG   Mycobacterium avium subsp. paratuberculosis MAP4: MAP4_3943Help
Entry
MAP4_3943         CDS       T02662                                 

Definition
aspartate aminotransferase AspC
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
mao  Mycobacterium avium subsp. paratuberculosis MAP4
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mao00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    MAP4_3943
   01230 Biosynthesis of amino acids
    MAP4_3943
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MAP4_3943
   00290 Valine, leucine and isoleucine biosynthesis
    MAP4_3943
Enzymes [BR:mao01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     MAP4_3943
    2.6.1.66  valine---pyruvate transaminase
     MAP4_3943
Amino acid related enzymes [BR:mao01007]
 Aminotransferase (transaminase)
  Class I
   MAP4_3943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4280650..4281942)
Genome map
AA seq 430 aa AA seqDB search
MDSDGTIGGVTTHQLPVHSSAHHRQQRTFAQSSKLQDVLYEIRGPVHQHAARLEAEGHRI
LKLNIGNPAPFGFEAPDVIMRDMIQALPYAQGYSDSQGILPARRAVVTRYELVDGFPRFD
VDDVYLGNGVSELITMTLQALLDNGDEVLIPSPDYPLWTASTSLAGGTPVHYLCDETQGW
QPDIADLESKITERTKALVVINPNNPTGAVYSGEILSQMVDLARKHELLLLADEIYDKIL
YDDAKHINVASLAPDMLCLTFNGLSKAYRVAGYRAGWLAITGPKDHAGSFIEGINLLANM
RLCPNVPAQHAIQVALGGHQSIEDLVLPGGRLLEQRDVAWSKLNEIPGVSCVKPAGALYA
FPRLDPEVYDITDDEQLVLDLLLQEKILVTHGTGFNWPAPDHLRIVTLPWARDLAAAIER
LGNFLVGYRQ
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
gtggacagtgatggcaccattggtggtgtgacaacccaccagctgcctgtgcactcgtcc
gcgcaccatcgccagcagcgtactttcgcccagtcgtccaagctccaggacgtcctgtac
gagatccgcggcccggtacatcagcacgcggcgcggctggaggccgagggacaccgcatc
ctcaagctcaacatcggcaacccggcgccgttcggcttcgaggcgcccgacgtcatcatg
cgcgacatgatccaggccctgccgtacgcccagggctactccgactcgcagggcatcctg
cccgcgcgccgggcggtggtcacccgctacgagttggtcgacgggttcccccgcttcgac
gtcgacgatgtctacctgggcaacggcgtgtccgaactgatcacgatgacgctgcaggcg
ctgctcgacaacggcgacgaggtgctgatcccgtcgccggactacccgctgtggacggcg
tcgacctcgctggccggcggcacccccgtgcactacctgtgcgacgagacgcagggctgg
cagcccgacatcgccgatctggaatccaagatcaccgagcgcaccaaggcgctggtggtg
atcaacccgaacaacccgaccggcgcggtgtacagcggcgaaatcctgagccagatggtc
gatctggcgcgcaagcacgagctgctgctgctggccgacgagatctacgacaagatcctc
tacgacgacgccaagcacatcaacgtggcgtcgctggcgccggacatgctgtgcctgacc
ttcaacggcctgtcgaaggcgtaccgggtggccggctaccgggccggctggctggcgatc
accggacccaaggaccacgccggcagcttcatcgagggcatcaacctgctggccaacatg
cggctgtgcccgaacgtcccggcgcagcatgcgatccaggtggccctgggcggccaccag
agcatcgaggacctggtgctgccgggcgggcggctgctcgagcagcgcgacgtggcgtgg
agcaagctcaacgagatccccggggtgtcctgcgtcaaacccgccggcgccttgtacgcg
tttccccggctggaccccgaggtctacgacatcaccgacgacgagcagctggtgctcgac
ctgctgctgcaggagaagatcctggtcacccacggcaccggcttcaactggccggcgccg
gatcacctgcgcatcgtgacgctgccgtgggcgcgggacctggccgccgcgatcgagcgg
ctgggcaacttcctggtcggctatcgacagtaa

DBGET integrated database retrieval system