KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_0083Help
Entry
Maqu_0083         CDS       T00454                                 

Definition
(GenBank) putative D--3-hydroxybutyrate oligomer hydrolase lipoprotein transmembrane
  KO
K07518  
hydroxybutyrate-dimer hydrolase [EC:3.1.1.22]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:maq00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Maqu_0083
Enzymes [BR:maq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.22  hydroxybutyrate-dimer hydrolase
     Maqu_0083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
104424..106526
Genome map
AA seq 700 aa AA seqDB search
MKRMMLCTLIGAATVTLTACKKDEVFNSLPDFLVSDVRQFDYDGNTDDLLTAGLGPEGLA
SATPPAFVDALNPTPAELRRLAIYNNYRALVDTAPGGGYGSLFGPAVGNASGRIPGQEFI
AMMQVPGATVPVTVMAQVPDSFDPDFPCMVTAPSSGSRGIYGAIGTAGEWGLKKGCAVVY
TDKGTGTGAHNLATNTAQSVNGTLTMEPEEALFRADLDAQSRDDFNSQWPDRFAWKHAHS
KQNPEADWGRHVLQSIEFGFYMLNTLHGRELGNGETLRTINPRNTLVIASSVSNGGGASV
RAAEQDEKGLIDGVAVSEPNVNPAVDRSFSIRQGNGPALTEHSRSLLDYTTALAVYQGCA
NQAPGIRDLAPLNGMFNPPATGQNICHSLFNKGLVSGATKDDWALDAQRILNEDFGVQPE
QNLLAPVHFGLAVAQSIAMTYANAYGRAGVEDRVCGLSLAATGSAGAVVPLAPAAEASLF
AASNGIPPSAGVNLVYDNAEGQPTSLAVSASPSSSQVDYGLDALLCLRSLAEGRDVVTGE
PLEGAQAELHEAISRGISAVRASGDLQRKPTVFVTGRADAILPINHTSRPYVGLNQAVEG
RHSNLRYYEILNAHHLDVLNGFPGIGDRYVPLHHYYFQALDLMWARLTDKQPLPPSQVVR
TVPRGSLTTPLTLANLPPIQSEPAEADRIVFTGNQLQIPD
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaatgatgctctgcaccctgataggtgctgccacggtaacgctcactgcctgc
aagaaggacgaggtgttcaactccttgcctgatttcctggtgagcgatgtccggcagttc
gattacgatggcaataccgatgatcttcttaccgctggcctggggccggagggtctggcc
agtgccacaccaccggcgtttgtcgatgccctgaatccgacaccggcagagttgcgccgg
ctggccatctacaacaattaccgggcgctggtggataccgcacccggcggaggttatggc
agcctgtttggcccggccgtgggtaacgccagtggccgaattccgggccaggaattcatt
gccatgatgcaggtgccgggcgccactgtgccggtgacggtaatggcccaggtgcccgac
agctttgatccggattttccgtgcatggtaaccgcgccctcctcgggttcccgcgggatc
tacggcgccattggcaccgccggggagtggggcctgaaaaagggctgcgcagtagtttat
accgataaaggcaccggtaccggcgcccataacctcgccacaaacaccgcccagtccgtg
aacggaacactcaccatggaacctgaagaagccttgttccgggcagatctggacgctcag
agccgggatgatttcaatagccagtggccggatcgcttcgcctggaaacacgcccattcc
aaacagaacccggaggcagactggggccggcatgtgttgcaatccattgagttcggcttc
tatatgctgaacacactccatggccgggaactgggtaatggtgaaactctccggaccatc
aacccgaggaacaccctggtgattgcctccagtgtttccaacggcggcggagcctcggtg
cgggcggcggaacaggacgagaaaggcctgattgatggtgtggcggtgtctgagcccaat
gtgaatccggctgtggaccggagtttcagcattcgtcagggcaatggccctgcactgacg
gaacacagccgcagcctgctggattacaccaccgcgctggcggtgtaccagggttgtgcc
aaccaggcccccggcatccgcgatcttgcccccctgaacggcatgttcaacccgccggcg
actggccagaacatctgccactccctgttcaataaggggctggtgtctggcgcaaccaag
gatgactgggccctcgatgcgcaacggatcctgaacgaggacttcggcgtgcagccggag
cagaacctgctggcgccggtgcattttggcctggcggtcgcccagagcattgccatgacc
tacgccaatgcctatggccgcgcgggtgttgaagaccgggtgtgtggcctgagcctcgca
gcgaccggcagcgccggtgcggtggtgccactggcgcctgcggccgaggcgtcgctgttt
gcagcgagtaacggcattccgccctccgccggtgtcaatctggtctacgacaacgccgag
ggccagcccacgagcctcgccgttagcgcttcgcccagttccagccaggtggattacggt
ctggacgccctgttgtgcctgagaagtcttgccgaaggcagggatgtggtcaccggcgag
cccctcgagggcgctcaggctgagctgcacgaagccatcagccgtggcatttcagcggtg
cgggccagcggagacctgcagcgcaagccgacggtatttgtcaccgggcgggctgatgcc
atcctgcccattaaccacacctcccggccctatgtcggcctgaaccaggcagtggaaggt
cgccacagcaacctgcgctattacgaaattctcaacgcccatcatctggatgtactcaac
ggctttccgggcatcggtgaccgctatgtgccgttgcatcactattacttccaggcgctg
gatctgatgtgggcccgtctcaccgacaagcagccactgcctcccagtcaggtagtgcgt
acggtgccccggggcagcctgaccacccccctgaccctggcgaacctgccgccgattcaa
tccgaaccggcggaagcggaccggattgtcttcaccggtaaccagttgcagatcccggac
tga

DBGET integrated database retrieval system