KEGG   Marinobacter aquaeolei: Maqu_0359Help
Entry
Maqu_0359         CDS       T00454                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
maq  Marinobacter aquaeolei
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:maq00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:maq00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
416418..416966
Genome map
AA seq 182 aa AA seqDB search
MMRWTVLKCVSVLLLLGLTVPAVARDCPDFLDHEQRKLHSRDSVNLCEVAAGKPMLVVNT
ASRCGYTGQFEGLEALHQRYKDRGLMVVGFASDDFRQEADSEEEAAKVCFVNFGVSFTMI
APSAVTGEQANPVFQEINRQSQPPRWNFTKYVIDGDGKVTARFPSQVRPEDARLIQALES
VL
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgttggacagtcttgaagtgtgtgagtgtgcttttactgttagggttgacggtg
cctgccgttgcccgggattgcccggatttcctggaccacgagcagcgcaagctgcactcc
cgggattcggtgaatctgtgcgaggtggctgctggcaagccgatgctggtggtgaacaca
gccagccgttgtggttataccggtcagtttgaaggcctggaggccctgcaccagcggtac
aaggatcgggggctgatggtcgtgggatttgccagtgatgacttccggcaagaggcggat
tccgaagaagaggccgcgaaggtctgttttgtgaactttggcgtgagttttaccatgatc
gcgccgagcgcagtgaccggtgagcaggccaatccggtgtttcaggaaatcaatcgccag
agccagccgccacgctggaacttcaccaagtatgtgatcgatggtgacggtaaggtgacg
gcccgtttcccgagccaggtgcgccccgaggatgcccggttgattcaggccctggaatcg
gttctgtaa

DBGET integrated database retrieval system