KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_0459Help
Entry
Maqu_0459         CDS       T00454                                 

Definition
phospholipase A(1) (EC:3.1.1.32)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:maq00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Maqu_0459
   00565 Ether lipid metabolism
    Maqu_0459
   00590 Arachidonic acid metabolism
    Maqu_0459
   00591 Linoleic acid metabolism
    Maqu_0459
   00592 alpha-Linolenic acid metabolism
    Maqu_0459
Enzymes [BR:maq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     Maqu_0459
    3.1.1.32  phospholipase A1
     Maqu_0459
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(522806..523903)
Genome map
AA seq 365 aa AA seqDB search
MTPSLKLLPLILLGTANLVVAQDRPEEPDVNCALIKEGVQRLACYDAKYNPQAERDQASE
EQLEEAEADAEELVADKKTREKIVGNALEDDPDDGVMAALVDNYLSAERAIFSFTGSFVT
HQPNYILPITWVDDPNALPASPRLGAIDYDYNLENEEAKYQISFKVPLLTGIFDDRTTFW
FGYTQKSFWQVYNQDESAPFRETNYEPELFFRHALNWDLGPGTLSAVSVGFNHQSNGQPD
PRSRSWNRIMGSVAYSVDRWLFMVQPWYRLPENSSSDDNEDIESYLGHASYHAVYKLTED
RTFSLKLLNNLRSDNRTSVEFGYSFPMGDTLKGFFQYYNGYGESLIDYNERIERVGFGIM
LNDWL
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgacccccagcctcaagctgctacccctgattctgttgggcacggccaatctggttgtt
gcccaggatcggccagaggaacccgatgttaactgcgcgctgatcaaggaaggtgtgcaa
cggctggcctgctatgacgccaagtacaaccctcaggccgagcgtgaccaggccagcgag
gaacagctggaagaagccgaggcggatgcagaggaactggtggccgacaagaaaacccgg
gagaagatcgtgggtaatgccctggaagacgatcctgatgacggggtgatggccgcgctg
gtggacaactatctttctgccgagcgggcgatcttctcgtttaccggcagtttcgtgact
catcagcccaattacattctgccgatcacctgggtggacgaccccaatgccttgcccgca
agcccgcgactgggagctatcgattatgactacaacctggaaaacgaggaagccaagtac
cagatcagcttcaaggttccgttgctgacgggcattttcgacgaccgcacaaccttctgg
tttggctacacccagaaatccttctggcaggtctacaaccaggatgaatcggcgcctttc
cgggagaccaactatgagccggagctgtttttcaggcacgccctgaactgggatctcggt
cccggtacgctcagtgcggtgtcggtgggctttaatcaccagtcaaacggacagcctgac
ccccggtcccggagctggaaccggattatgggttccgttgcctatagtgtggatcgctgg
ctgtttatggttcagccctggtatcgcttgccggaaaacagcagcagcgacgacaacgaa
gacatagagagctatctgggccacgccagttatcacgcggtttacaagctgacggaagat
cggacgttttctttgaagctgctgaataatctgaggtcggataaccggacgtcggtggag
ttcgggtacagctttcccatgggggatacgctgaaggggttcttccagtattacaacggt
tatggggagagcctgattgactataacgagcggattgagcgggtcgggtttggcattatg
ctgaatgactggctctag

DBGET integrated database retrieval system