KEGG   Marinobacter aquaeolei: Maqu_0498Help
Entry
Maqu_0498         CDS       T00454                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
maq  Marinobacter aquaeolei
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
565751..567136
Genome map
AA seq 461 aa AA seqDB search
MASEDSWKEKYLRELEEAEHREKQWESERNLLERMLVRTSLASEGQRPELDELLGRLRED
IRKKQINLQHWRELQDQIDRQITLLDEQAGPQAVSPTPEPQAPAEGVDLADTTQRLRIAR
RIGQLLGQLLQQASLEPAAEAEARELQQTLLTSNDWEVLREGLNRVADLVIAAITRSQRE
FEAFLKRLDERLQALREHFAQQSDVQTGRQDATATLDREIRAELDKVGDDIRASEDIQAL
KQSVSQRLEFIGSALERFRTSESEREKLLANQLEAMQEKVAAMEAHSEQMQAQVREERQR
ALTDLLTQLPNREAWQERLSFEYNRWLRYRHPLTVAVLDVDLFKRINDSYGHKAGDRVLQ
LVAREMSTRLRSTDFIARFGGEEFVVLLPETPTDEARKVLDSLREHVSGLPFHFSGEPVS
ITFSAGLTGFQDDDTEESVFDRADRALYQAKDEGRNRVSVL
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggcatctgaagattcctggaaagagaaatatctcagggaactggaagaagcagagcat
cgggaaaaacagtgggaatccgaacgtaatctgctggaacgaatgctggtacgaaccagt
ctggcctctgaaggacagcgaccggagctggacgaattgttgggtcggttgcgggaggat
atccgtaagaagcagatcaacctgcagcattggcgggagctgcaggaccagattgaccgg
cagattaccctgctggacgagcaggccgggcctcaggctgtgtcgcccacaccggaaccg
caagccccggcagaaggtgtggatctggcggataccacacagcgactgagaattgcacgc
cgcatcggccagttactggggcaactgttgcaacaggcttccctggagccggccgcagaa
gcagaagcccgggaattacagcagaccttgctgaccagcaacgactgggaagtgctccgg
gaggggctgaaccgggtcgccgacctggtgatcgccgccatcacccgcagccagcgcgaa
ttcgaggccttcctgaaacgcctggatgagcgcttgcaggcgttacgggagcattttgcc
cagcagagcgatgtccagactggccggcaggacgccacagcaacgctggaccgggaaatc
cgtgccgagctggacaaggtgggggatgacatccgcgccagcgaggatattcaagctttg
aagcagtcggtcagtcaacgcctggaatttattggcagtgcgctggagcggttccggacg
tcggaaagcgagcgtgaaaaactgctggcgaaccaactggaagccatgcaggagaaagtc
gcggccatggaggcccattcggaacagatgcaggcccaggtgcgtgaagagcgtcagcga
gccctgaccgatctgctcacccagctgcccaaccgtgaagcctggcaggagcggctgtcg
tttgaatacaatcgctggttgcgctaccggcacccgctcacggtggctgtgctggacgtg
gatctgttcaagcgcatcaacgattcctatggccacaaggcaggggatcgcgtgctgcag
ttggtggcccgggagatgagcactcgcctgcggtcgacggattttatcgcccggttcggt
ggcgaggagtttgtggtgcttctgccggaaacgcccacagatgaagcccgcaaggtattg
gattccctgcgcgaacatgtatccggcctgccgttccatttcagcggcgagccggtaagc
attaccttttcagcggggctgaccggttttcaggacgacgacaccgaagagtcggtgttt
gaccgggctgatcgggccctctatcaggccaaggatgagggccgaaatcgggtgtcggtg
ctctga

DBGET integrated database retrieval system