KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_0498Help
Entry
Maqu_0498         CDS       T00454                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Brite
Enzymes [BR:maq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Maqu_0498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
565751..567136
Genome map
AA seq 461 aa AA seqDB search
MASEDSWKEKYLRELEEAEHREKQWESERNLLERMLVRTSLASEGQRPELDELLGRLRED
IRKKQINLQHWRELQDQIDRQITLLDEQAGPQAVSPTPEPQAPAEGVDLADTTQRLRIAR
RIGQLLGQLLQQASLEPAAEAEARELQQTLLTSNDWEVLREGLNRVADLVIAAITRSQRE
FEAFLKRLDERLQALREHFAQQSDVQTGRQDATATLDREIRAELDKVGDDIRASEDIQAL
KQSVSQRLEFIGSALERFRTSESEREKLLANQLEAMQEKVAAMEAHSEQMQAQVREERQR
ALTDLLTQLPNREAWQERLSFEYNRWLRYRHPLTVAVLDVDLFKRINDSYGHKAGDRVLQ
LVAREMSTRLRSTDFIARFGGEEFVVLLPETPTDEARKVLDSLREHVSGLPFHFSGEPVS
ITFSAGLTGFQDDDTEESVFDRADRALYQAKDEGRNRVSVL
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggcatctgaagattcctggaaagagaaatatctcagggaactggaagaagcagagcat
cgggaaaaacagtgggaatccgaacgtaatctgctggaacgaatgctggtacgaaccagt
ctggcctctgaaggacagcgaccggagctggacgaattgttgggtcggttgcgggaggat
atccgtaagaagcagatcaacctgcagcattggcgggagctgcaggaccagattgaccgg
cagattaccctgctggacgagcaggccgggcctcaggctgtgtcgcccacaccggaaccg
caagccccggcagaaggtgtggatctggcggataccacacagcgactgagaattgcacgc
cgcatcggccagttactggggcaactgttgcaacaggcttccctggagccggccgcagaa
gcagaagcccgggaattacagcagaccttgctgaccagcaacgactgggaagtgctccgg
gaggggctgaaccgggtcgccgacctggtgatcgccgccatcacccgcagccagcgcgaa
ttcgaggccttcctgaaacgcctggatgagcgcttgcaggcgttacgggagcattttgcc
cagcagagcgatgtccagactggccggcaggacgccacagcaacgctggaccgggaaatc
cgtgccgagctggacaaggtgggggatgacatccgcgccagcgaggatattcaagctttg
aagcagtcggtcagtcaacgcctggaatttattggcagtgcgctggagcggttccggacg
tcggaaagcgagcgtgaaaaactgctggcgaaccaactggaagccatgcaggagaaagtc
gcggccatggaggcccattcggaacagatgcaggcccaggtgcgtgaagagcgtcagcga
gccctgaccgatctgctcacccagctgcccaaccgtgaagcctggcaggagcggctgtcg
tttgaatacaatcgctggttgcgctaccggcacccgctcacggtggctgtgctggacgtg
gatctgttcaagcgcatcaacgattcctatggccacaaggcaggggatcgcgtgctgcag
ttggtggcccgggagatgagcactcgcctgcggtcgacggattttatcgcccggttcggt
ggcgaggagtttgtggtgcttctgccggaaacgcccacagatgaagcccgcaaggtattg
gattccctgcgcgaacatgtatccggcctgccgttccatttcagcggcgagccggtaagc
attaccttttcagcggggctgaccggttttcaggacgacgacaccgaagagtcggtgttt
gaccgggctgatcgggccctctatcaggccaaggatgagggccgaaatcgggtgtcggtg
ctctga

DBGET integrated database retrieval system