KEGG   Marinobacter aquaeolei: Maqu_0529Help
Entry
Maqu_0529         CDS       T00454                                 

Definition
RdgB/HAM1 family non-canonical purine NTP pyrophosphatase
Orthology
K02428  
dITP/XTP pyrophosphatase [EC:3.6.1.19]
Organism
maq  Marinobacter aquaeolei
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:maq00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:maq00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(601898..602497)
Genome map
AA seq 199 aa AA seqDB search
MARKLVIASNNKGKIAELTDLLAPLGLQPVAQGELGVSEAEEPAVTFVENAIIKARHAAR
VTGLPALADDSGLAVDALDGRPGVRSARFAGEEATDNDNVEALLAALKDTPEAERSAQFH
CVLVYLRHADDPTPIICHGRWPGRILAEPRGQGGFGYDPVFLVPEHGCSAAELTREQKGR
ISHRGRALASLLDQLRAEL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcaaactcgtcatcgccagcaacaacaagggcaagatcgccgaactgactgat
ctgctcgcgccacttggcttgcagccggtcgcccagggtgagcttggggtatcagaggcc
gaagaaccggccgttaccttcgttgagaatgccattatcaaagcccgccatgcagcgaga
gtcactggcctgcctgcgctggccgacgacagtggcctggccgtggatgccctggacggc
cgcccgggcgttcgctccgcccgctttgccggcgaagaggcaaccgacaatgataatgtc
gaggcgttgctggcagcgttgaaagacacgcctgaagcagagcgcagcgctcagtttcac
tgcgttctggtttatctccgccatgctgacgatcccacgccgatcatctgccatggtcgc
tggccaggccgcattcttgccgagccgcgcgggcaaggcggcttcggttacgacccggtc
tttctggtaccggagcatggatgcagcgctgccgagctgacacgggagcagaaaggcagg
atcagccatcggggacgggctctggccagccttctggatcaactcagggcggagctttaa

DBGET integrated database retrieval system