KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_0634Help
Entry
Maqu_0634         CDS       T00454                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:maq00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Maqu_0634
Enzymes [BR:maq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Maqu_0634
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
729361..729993
Genome map
AA seq 210 aa AA seqDB search
MKQAGGQGTLFVISAPSGAGKTSLVSEMLRQDSRLGVSVSHTTRPMRDGEQDGVNYHFIS
RDEFEAMIARGDFLEHADVFGNYYGTSQVWVRETLATGQDVILEIDWQGAEQVRRLVPEC
VSIFIVPPSAEILRQRLVGRGTDAPEVIERRLSEAEEECRHAVEFDYLVVNDDFAVALAD
LLAIVRSQRLKMATQQVRHGELLRDLSAHG
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaggccggtgggcagggtaccctgtttgtgatttccgctccttccggcgcgggc
aagaccagcctcgtgtcggaaatgctccgtcaggattcccggttgggggtgtcggtatcc
cacaccactcgcccgatgcgcgatggagagcaggatggcgtgaactatcacttcatcagc
cgggatgagttcgaggccatgattgcccggggtgatttcctggagcatgcggatgttttc
ggcaactactatggcacctcccaggtgtgggtgcgggaaaccctcgctaccgggcaggat
gtgatcctggagattgactggcagggggcggaacaggtgcgccggctggttccggaatgt
gtgagcattttcattgtgccgccctcggctgaaatcctgcgccagcggcttgttggccgt
ggtactgacgcaccggaagtcattgaacggcggctgtcggaggcggaggaagagtgccgg
cacgcggtcgagtttgattacctggtggtcaacgatgactttgcggtggctttagctgat
ctgctggccattgtccgcagtcagcggctgaaaatggccacccagcaggttcgccacggt
gagttgctgcgggacttgtccgctcacgggtga

DBGET integrated database retrieval system