KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_0858Help
Entry
Maqu_0858         CDS       T00454                                 

Definition
(GenBank) glutamate 5-kinase (EC:2.7.2.11)
  KO
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:maq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Maqu_0858
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Maqu_0858
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Maqu_0858
Enzymes [BR:maq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Maqu_0858
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
975436..976521
Genome map
AA seq 361 aa AA seqDB search
MVKIGSALLTNDGKGLDVAALGLWVDQIAELIADGVEVVVVSSGSVAEGMSRLGWTVRPQ
HLHELQAAAAVGQMGLVQTWEAQFKRHDIHTAQILLTHDDLSDRKRYLNGRSTLRTLLDY
GVVPIVNENDTVVTDEIRFGDNDTLGALVANLIEADGLIILTDQVGLFNKDPRKHGDAVL
VTERRAEDRELDAMAGGGAGALGRGGMQTKLRAARLAARSGAFTVIVGGRIEHVIARLRQ
GDVIGTLLLPEQGRLAARKQWIASHLQTRGKLTLDDGAVKVLRQGGRSLLPVGVKAVSGQ
FRRGEMVSCVDLAGKEIARGLVNYDADEARAISGRSSDRINDVLGYVSDEEMIHRDNLVV
V
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtggtcaagatcggtagtgccttgctgaccaatgatggcaaaggtctggatgttgccgca
ttggggctgtgggtagatcagattgccgagctgattgccgacggtgtagaggtggtggtg
gtgtcgtctggctcggtggctgagggcatgagtcgcctgggctggacggttcgccctcag
catttgcacgagctgcaggccgcggcggccgtggggcagatggggcttgtccagacctgg
gaggcccagttcaagcgccatgatattcatacggcgcagatcctgctgacccacgacgac
ctctccgaccgcaagcgttacctgaacggccgcagcaccctgcgcacgctgctggattac
ggcgtggtaccgatcgtgaacgaaaacgatacggtggtgaccgacgagatccggtttggt
gataacgacaccctgggcgcgctggtggccaacctgattgaggcggatggtctgattatt
ctgaccgatcaggtggggttgtttaataaagacccccgcaagcacggcgatgccgtgctt
gtgaccgagcgcagggcggaagatcgcgagctggatgccatggccggcggtggtgccgga
gcgctcgggcgcggtggtatgcagaccaagctgagggcggcccggttagcggcccgctca
ggcgcgtttaccgtgattgttggtggccggattgagcatgtgattgcccgattacgccag
ggtgatgtgattggcaccttgctgttgccggagcaggggcggctggcggccagaaagcag
tggattgccagtcacttgcaaacccggggcaagctcacgctggatgatggtgcggtgaag
gtgttgcgccagggtggacggagtctgttgccggtgggtgtgaaggcggtgtcagggcag
ttccggaggggggagatggtctcctgtgttgatctggctggcaaagaaatcgcgcggggg
ctggttaactatgatgctgatgaagccagggccatctcgggtcggtccagtgatcgcatt
aacgatgttctgggctatgtgtccgatgaggagatgatccatcgggataatctggtggtg
gtttga

DBGET integrated database retrieval system