KEGG   Marinobacter aquaeolei: Maqu_0908Help
Entry
Maqu_0908         CDS       T00454                                 

Definition
acireductone dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
maq  Marinobacter aquaeolei
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:maq00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1038198..1038755
Genome map
AA seq 185 aa AA seqDB search
MTTLSIFHQNQPEQAQTVVTDPDTIRNKLSAHGVHFDRWATRDLPADATQEEILEAYADE
VARLKQDWGFQTADVVSLTADHPQKDAFRQKFLDEHTHSEDEVRFFVRGQGLFYLHFGDQ
VYALLCEKNDLISVPDGTRHWFDMGPEPEFTCIRLFSNPEGWVASFTGEDIASRLPRYES
LAGGA
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccctgagcatttttcatcagaaccagcccgagcaggcccagacggtcgtaaca
gacccggacaccatccggaataaactgagtgcccacggtgtgcatttcgatcgttgggca
acccgcgatctgccggccgatgccactcaggaggaaattcttgaggcctatgccgacgaa
gtggcacggctcaagcaggattgggggtttcagaccgccgacgtggtcagcctgaccgcg
gatcatccccagaaagacgcgttccgccagaaatttctggatgagcacacccacagcgag
gacgaagtgcgcttcttcgttcgtggtcaggggttgttttacctgcacttcggtgaccag
gtatacgcgctgctgtgcgagaagaatgacctgatcagtgtgcctgacggcacccggcac
tggtttgatatggggccggagcctgaattcacctgtatccggttattcagcaacccggaa
ggctgggttgcgagctttaccggtgaggatatcgcttcccggctgccacgttatgagagc
ctggcgggaggggcctga

DBGET integrated database retrieval system