KEGG   Marinobacter aquaeolei: Maqu_0927Help
Entry
Maqu_0927         CDS       T00454                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
maq  Marinobacter aquaeolei
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1057933..1058589
Genome map
AA seq 218 aa AA seqDB search
MTAQLEGIGMTSRRTRMRLVQRLREGGIESDRVLEVIGQVPRHIFLDEALSHRAYEDTSL
PIGHGQTLSQPYIVARMTELLLAHAPQRVLELGTGSGYQTAVLSQLFPEIYSVERIRPLQ
DRARDRLRQLNVRNVLLKHADGGMGWPERGPFDGIIVTAAPVEVPRELLDQLADGGVLIA
PVGEENQVLVEIIRKGNHFERHNLEPVHFVPLLGGVIR
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgacggcccagctcgaaggcattggtatgacatcacggcgcacgcgcatgcgtctggtg
cagcgcctgcgtgaggggggaatagagtctgaccgggtgcttgaggtgattggccaggtg
ccccggcatatttttctggatgaggcgttgtcacaccgggcctacgaggatacttcgctg
cccatcgggcatggccagactctttcccaaccctacatcgtcgcccggatgactgagctg
ttactggcccatgcgccgcaacgggtgctggaactggggaccggctccggttaccagacg
gccgtgctttcgcaactgttccccgagatctacagcgttgagcgtatccgcccgctccag
gatcgcgcccgggaccggctgcgccagttaaacgtgcgcaatgtcctgctcaaacatgcg
gatggtggtatgggctggccagaacgagggcccttcgatggcatcatcgtaacggcagcc
ccggtggaggttcccagagaactgctggatcagctggccgatggtggcgtgctgatagcc
ccggtgggggaagagaatcaggtgttggtggagattatccgcaaaggcaatcactttgag
cgccacaatcttgaaccggtgcattttgtgcctttgttgggtggagttatccgttaa

DBGET integrated database retrieval system