KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_1048Help
Entry
Maqu_1048         CDS       T00454                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
maq00010  Glycolysis / Gluconeogenesis
maq00071  Fatty acid degradation
maq00350  Tyrosine metabolism
maq00625  Chloroalkane and chloroalkene degradation
maq00626  Naphthalene degradation
maq01100  Metabolic pathways
maq01110  Biosynthesis of secondary metabolites
maq01120  Microbial metabolism in diverse environments
maq01130  Biosynthesis of antibiotics
maq01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:maq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Maqu_1048
  Lipid metabolism
   00071 Fatty acid degradation
    Maqu_1048
  Amino acid metabolism
   00350 Tyrosine metabolism
    Maqu_1048
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Maqu_1048
   00626 Naphthalene degradation
    Maqu_1048
Enzymes [BR:maq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Maqu_1048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: ABM18140
UniProt: A1TZH1
Position
complement(1200460..1201647)
Genome map
AA seq 395 aa AA seqDB search
MTNKYYEFFCPVKVIAGKAALEHIPYELTGLAAKRPMIVTDKGVRAAGLLDPVIAACEES
GLEIVSIYDDVPPDSSTSVVKDIASVYRKEKCDSIIAVGGGSAIDTGKAVNILVSEGGDN
IAKYSGAGVLKHPLKPFFVVPTTAGTGSEVTSVAVITDEKKGVKLPFTSSFLLPNAAIID
PRMTLTLPPHITAATAMDALTHATEAFTCMAKNPLSDAYATAAIKKVSQSLLSVMDNPKD
SDGRLELAQASTMAGIAFSNSMVGLVHSLGHATGAICHLPHGLCMSLYLPYVLEFNLESI
REPLGELLLYLEGPEVYSATPASRRAEASISAIRKLRDALYKRCELPRTLKETGKVLENQ
LEGIAKLALDDGSIMFNPREVSHEDAMSVLRRAWA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacaaatactacgagttcttctgcccggtaaaagtgattgccggtaaagccgcg
ctggagcacattccctatgaactgacaggcctggcagccaaacggcccatgattgtgacc
gataaaggggtgcgcgcggcgggcctgctcgacccggtgattgccgcttgcgaagaaagc
gggctggaaattgtctccatctacgacgatgtgccgccggattcctccacctcagtggtg
aaagacattgccagcgtttaccgcaaggaaaaatgcgactcgatcattgcggtgggcggc
ggctccgccattgataccggcaaggcggtcaatattctggtatccgaaggcggcgataat
atcgccaaatacagtggcgccggtgttctcaagcacccgctcaagccgttctttgttgtg
cccaccacggcgggtaccggttccgaggtaacctcggtggcggtcatcaccgatgagaaa
aaaggcgtaaaacttccgtttacctcatcattcctgctgccgaacgcggccatcatcgac
ccgcgtatgaccctgaccctgccgccccacattacggcagccaccgccatggacgccctc
acccatgctaccgaagcgttcacctgcatggccaagaaccccttgagcgacgcctatgcc
acggcggccatcaagaaggtgagccagtctctgctctctgtcatggataacccgaaagac
agcgatggccggctggaactggcgcaggcgtccaccatggcgggcattgccttctccaac
tccatggtgggtctggtgcattctctcggccacgctaccggagccatctgccacctgccc
cacggcttgtgcatgagcctgtatctcccgtacgtactggagttcaaccttgagagcatt
cgcgagcctttaggcgagctgcttctgtacctggaaggcccggaggtctattccgccacc
cccgcgagccgacgcgcagaggccagcatttccgccattcgcaaactgcgggatgcgctt
tacaaacgttgcgaactgccccgcaccttgaaagaaaccggaaaagttcttgaaaatcaa
ttggaaggcattgccaagctagccctggacgacggttcgatcatgttcaacccccgggaa
gtgagccacgaagacgccatgtcggttctgcgtcgcgcctgggcctga

DBGET integrated database retrieval system