KEGG   Marinobacter aquaeolei: Maqu_1151Help
Entry
Maqu_1151         CDS       T00454                                 

Definition
succinate dehydrogenase, hydrophobic anchor subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
maq  Marinobacter aquaeolei
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:maq01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:maq00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:maq00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:maq00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1309424..1309765
Genome map
AA seq 113 aa AA seqDB search
MNSVTNIGRNGIQDWIIQRVTAYVLALYTLFLLGFFVTTDVDYQAWSALFAQGWFKIFSL
LALLSIAGHAWVGLWTVSTDYIKSAMPRFLLQAACVLVMFVYVVWGIQILWGL
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgaacagtgtaacgaatattggtcgtaacggtattcaggactggatcatccagcgcgta
acagcctacgtattagctctgtacacgctgttcctgcttggcttctttgtgaccaccgat
gttgactaccaggcgtggtctgcattgtttgctcagggatggttcaagatcttcagtctg
cttgcgctgctgtccattgccgggcacgcgtgggttggcttgtggacagtttctaccgac
tacatcaaatccgcgatgccgcgttttctgcttcaggcagcctgtgtgctcgtaatgttt
gtatatgtcgtgtggggcattcagattctttgggggctttaa

DBGET integrated database retrieval system