KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_1155Help
Entry
Maqu_1155         CDS       T00454                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
maq00020  Citrate cycle (TCA cycle)
maq00310  Lysine degradation
maq01100  Metabolic pathways
maq01110  Biosynthesis of secondary metabolites
maq01120  Microbial metabolism in diverse environments
maq01130  Biosynthesis of antibiotics
maq01200  Carbon metabolism
Module
maq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
maq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:maq00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Maqu_1155
  Amino acid metabolism
   00310 Lysine degradation
    Maqu_1155
Enzymes [BR:maq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Maqu_1155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding HlyD_3 Biotin_lipoyl_2 Ribosomal_60s
Motif
Other DBs
NCBI-ProteinID: ABM18246
UniProt: A1TZS7
Position
1315441..1316664
Genome map
AA seq 407 aa AA seqDB search
MSTEIKAPVFPESVAEGTVATWHKQPGEACSRDELIVDIETDKVVLEVVAPADGVIEEVL
KNEGDTVESGEVIGKFKEGAAGESKPAESKSEAKAEAPKAEEKSEAASGDAILSPAARKL
AEENNVDPSAVKGTGKDGRVTKEDVQNYVDSNKSSGGAAAAKPAAMPEVNVGQGERAEKR
VPMTRLRASIAKRLVDAQQTAAMLTTFNEVNMAPIMELRKQYQDSFVKRHGIKLGFMSFF
TKAATEALKRFPAVNASIDGNDMVYHGYQDVGVAVSTDRGLVVPVLRDTDAMGLADIEKK
IVEYGTKAKEGKLAIEDMTGGTFTITNGGIFGSLISTPILNPPQTAILGMHKIQERPMAV
NGKVEILPMMYLALSYDHRMIDGKEAVQFLVAIKEMLEDPARILLDV
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacagagattaaagcccccgttttccctgagtcggttgccgaaggcaccgtcgcg
acctggcacaagcagccgggtgaggcctgttcccgtgacgagctgattgtcgatatcgaa
accgacaaggttgtgctcgaagtggttgcgccggcggatggtgtgatcgaagaagttctc
aagaacgaaggcgacaccgtggaaagcggtgaggtcatcggcaagttcaaggaaggcgca
gcaggtgaatccaagccggccgagagcaagtctgaagcgaaagccgaagcaccgaaagcc
gaggagaaatccgaagctgcttccggcgacgccattctgagcccggctgcccgcaagctg
gccgaagaaaacaacgttgacccgagcgcggtaaagggcaccggtaaagatggccgtgtt
accaaggaagacgttcagaactacgtggacagcaacaaatcttccggtggagcggctgcc
gccaagccggcagcgatgcctgaggtgaacgttggccagggcgagcgcgccgagaagcgg
gttccgatgacccgcctgcgtgccagcatcgccaagcgtctcgttgatgcccagcagaca
gcagccatgctgaccacctttaacgaggtgaacatggcgccgatcatggaactgcgtaag
cagtaccaggacagcttcgtgaagcgccacggcatcaagctgggcttcatgtcgtttttc
accaaagcggctaccgaagctctgaagcgcttcccggcagtaaacgcctccattgacggc
aacgacatggtttaccacggctatcaggacgtaggcgtagcagtatccaccgaccgtggc
ctggtggtaccggttctgcgtgacaccgacgccatgggtctggccgacatcgagaagaag
atcgtcgagtacggtaccaaggcgaaggaaggcaagctggccattgaagatatgaccggt
ggcaccttcaccatcaccaacggtggtattttcgggtctctgatctccacgccgatcctg
aatccgccccagactgccattctgggtatgcacaagatccaggagcgcccgatggcggta
aatggcaaggttgagattctgccgatgatgtacctggcgctgtcatacgatcaccgtatg
atcgatggcaaggaagcggtgcagttcctggtggcgatcaaggaaatgctggaagacccg
gcacgtatcctgctggatgtgtaa

DBGET integrated database retrieval system