KEGG   Marinobacter aquaeolei: Maqu_1155Help
Entry
Maqu_1155         CDS       T00454                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
maq  Marinobacter aquaeolei
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:maq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Maqu_1155
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Maqu_1155
  Amino acid metabolism
   00310 Lysine degradation
    Maqu_1155
Enzymes [BR:maq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Maqu_1155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1315441..1316664
Genome map
AA seq 407 aa AA seqDB search
MSTEIKAPVFPESVAEGTVATWHKQPGEACSRDELIVDIETDKVVLEVVAPADGVIEEVL
KNEGDTVESGEVIGKFKEGAAGESKPAESKSEAKAEAPKAEEKSEAASGDAILSPAARKL
AEENNVDPSAVKGTGKDGRVTKEDVQNYVDSNKSSGGAAAAKPAAMPEVNVGQGERAEKR
VPMTRLRASIAKRLVDAQQTAAMLTTFNEVNMAPIMELRKQYQDSFVKRHGIKLGFMSFF
TKAATEALKRFPAVNASIDGNDMVYHGYQDVGVAVSTDRGLVVPVLRDTDAMGLADIEKK
IVEYGTKAKEGKLAIEDMTGGTFTITNGGIFGSLISTPILNPPQTAILGMHKIQERPMAV
NGKVEILPMMYLALSYDHRMIDGKEAVQFLVAIKEMLEDPARILLDV
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacagagattaaagcccccgttttccctgagtcggttgccgaaggcaccgtcgcg
acctggcacaagcagccgggtgaggcctgttcccgtgacgagctgattgtcgatatcgaa
accgacaaggttgtgctcgaagtggttgcgccggcggatggtgtgatcgaagaagttctc
aagaacgaaggcgacaccgtggaaagcggtgaggtcatcggcaagttcaaggaaggcgca
gcaggtgaatccaagccggccgagagcaagtctgaagcgaaagccgaagcaccgaaagcc
gaggagaaatccgaagctgcttccggcgacgccattctgagcccggctgcccgcaagctg
gccgaagaaaacaacgttgacccgagcgcggtaaagggcaccggtaaagatggccgtgtt
accaaggaagacgttcagaactacgtggacagcaacaaatcttccggtggagcggctgcc
gccaagccggcagcgatgcctgaggtgaacgttggccagggcgagcgcgccgagaagcgg
gttccgatgacccgcctgcgtgccagcatcgccaagcgtctcgttgatgcccagcagaca
gcagccatgctgaccacctttaacgaggtgaacatggcgccgatcatggaactgcgtaag
cagtaccaggacagcttcgtgaagcgccacggcatcaagctgggcttcatgtcgtttttc
accaaagcggctaccgaagctctgaagcgcttcccggcagtaaacgcctccattgacggc
aacgacatggtttaccacggctatcaggacgtaggcgtagcagtatccaccgaccgtggc
ctggtggtaccggttctgcgtgacaccgacgccatgggtctggccgacatcgagaagaag
atcgtcgagtacggtaccaaggcgaaggaaggcaagctggccattgaagatatgaccggt
ggcaccttcaccatcaccaacggtggtattttcgggtctctgatctccacgccgatcctg
aatccgccccagactgccattctgggtatgcacaagatccaggagcgcccgatggcggta
aatggcaaggttgagattctgccgatgatgtacctggcgctgtcatacgatcaccgtatg
atcgatggcaaggaagcggtgcagttcctggtggcgatcaaggaaatgctggaagacccg
gcacgtatcctgctggatgtgtaa

DBGET integrated database retrieval system