KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_1157Help
Entry
Maqu_1157         CDS       T00454                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:maq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Maqu_1157
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Maqu_1157
   00640 Propanoate metabolism
    Maqu_1157
   00660 C5-Branched dibasic acid metabolism
    Maqu_1157
Enzymes [BR:maq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Maqu_1157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1318339..1319505
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQGKQLFAEYGLPVSKGIACDTPKEAVAAADEIGGDGWVVKAQVHAGGRGKAGGV
KLVKSKEEIREFAEKWLGKNLVTYQTDENGQPVSKILVESLTDIDQELYLGAVVDRGSRR
IVFMASTEGGVEIEKVAEETPEKILKAEIDPLVGAQPYQGRELAFKLGLEGKQIGQFTKI
FLGLAKLFEECDLALVEINPLVITPAGDLHCLDAKVGVDGNALYRQKKIHEMHDPSQEDS
REAEAAKWELNYVALEGNIGCMVNGAGLAMGTMDIIKLSGGQPANFLDVGGGATKERVSE
AFKIILSDDAVQAVLVNIFGGIVRCDMIAEGIIGAVKEVGVKVPVVVRLEGNNAELGTKV
LAESGLNIIAATSLADAAEQVVKAAGGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcacgaatatcagggcaagcagctgttcgctgagtacggcctgcccgtatcc
aaaggcattgcctgcgatactcccaaggaagccgtagcagcggcagacgaaatcggcggt
gacggctgggtagtgaaagcccaggttcacgccggtggtcgcggcaaggccggcggtgta
aagctggtcaagagcaaagaagagatccgtgaattcgccgaaaagtggctgggtaagaac
ctggttacctaccagaccgacgaaaacggccagccagtcagcaagattctggttgaatcc
ctcaccgacatcgatcaggaactttacctgggcgctgtggtagaccgtggttcccgtcgt
atcgttttcatggcctccactgaaggtggcgtggaaatcgagaaggttgccgaagaaact
ccggaaaagatcctgaaagccgaaattgatccgctggtcggcgcgcagccgtaccagggt
cgtgaactggcattcaagctgggcctggaaggcaagcagatcggtcagttcaccaagatt
ttcctgggcctggccaaactgtttgaagagtgcgacctggctctggttgagatcaacccg
ctggtgatcaccccggctggtgacctgcactgcctcgacgccaaagtaggtgtagacggc
aacgcactgtaccgtcagaagaaaatccacgagatgcacgatccctcccaggaagattcc
cgggaagcggaagcggccaagtgggagctcaactatgttgcgctggaaggcaacatcggc
tgcatggttaacggtgctggcctggccatgggcaccatggacatcatcaagctgtccggc
ggccagcctgccaacttcctggacgtaggcggcggcgcaaccaaagagcgcgtatccgaa
gcgttcaagatcatcctgtctgacgacgcggtacaggccgttctggttaacatcttcggt
ggtattgttcgctgcgacatgatcgctgagggcatcatcggtgcggttaaagaagtcggc
gttaaagtgcctgttgtggttcgtctggaaggcaacaacgcggagctgggtaccaaggta
ctcgccgaaagtggcctgaacatcatcgccgccaccagcctggcggacgccgcagagcaa
gtcgttaaagccgcagggggtaaataa

DBGET integrated database retrieval system