KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_1222Help
Entry
Maqu_1222         CDS       T00454                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Brite
Enzymes [BR:maq01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Maqu_1222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1382691..1383299
Genome map
AA seq 202 aa AA seqDB search
MNSHHELSRYLQQRGVLKSAMLIESFNAIDRKDFVSPGLQDEAYEDHPLAIGAGQTISQP
YTVAFMLELLQLEESDRILDVGCGSGWSTALLAQTAKSGFVTGVELVPELLELARDNLEK
YPLTNIRLELAGEALGIPGQTFDKILVSAAAEELPSELVDQLKPGGTMVIPVQNDMVVIF
KRKDGSIEQSEFSGFRFVPLIY
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaatagccaccacgaactctctcgttatctgcagcagcgcggagtgctcaagtctgcg
atgcttatcgagagtttcaatgcgattgatcgtaaagattttgtgagcccgggtttacag
gatgaggcttatgaggatcaccctcttgccatcggagcagggcaaacgatctcccaaccc
tacaccgtggctttcatgctggagcttttgcagcttgaagaaagcgaccgcattctggac
gtcggctgtggttcgggctggagcaccgcgcttttggcgcaaacggccaagtcgggtttt
gtgacgggggttgagctggttcccgagcttctggagctggcacgagataatctcgaaaaa
tacccacttaccaatatcaggctggagttagccggcgaggctctgggtattcctggacag
acgttcgacaaaatcctggtatccgccgcagcagaagagctgccttctgaactggtcgat
caactcaagcctggcggcaccatggtgatccctgtccagaacgatatggttgtgatcttc
aagcgtaaggacggcagcatcgagcagagcgagttctccggctttcgatttgttccgctt
atttactga

DBGET integrated database retrieval system