KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_1434Help
Entry
Maqu_1434         CDS       T00454                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:maq00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Maqu_1434
Enzymes [BR:maq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Maqu_1434
Exosome [BR:maq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Maqu_1434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1615120..1617015
Genome map
AA seq 631 aa AA seqDB search
MESPALSEFDLHLFAEGRHWHIYNVLGAHLVNHRGTEGTRFAVWAPNARAVSVIGDFNNW
DSGRHAMAVNNGYGVWSLFIPGVKAGHLYKFAITTRNGHHITKTDPYGQAFEHRPSNAAV
VTERGHYAWGDGDWLERRNRFDWQQSPISVYEVHPGSWRHHGSGRWLTYRELADQLVPYV
LETGFTHIELLPVTEHPLDESWGYQTTGYYAPTSRFGSPDDLRYFVDQCHQNNIGVILDW
VPGHFPDDDFALAEFDGTALYEHEDPRRGRHQDWGTLIYNYGRHEVRNFLIGSALFWLDT
FHMDGLRVDAVASMLYLNYSRNEGEWLPNEHGGHENLDAIRFLQDLNRVCQSRFPGVLMM
AEESTSWPRVTRPPEIGGLGFNLKWNMGWMHDTLHYLQQDPVYRQYHHDKLTFGLLYAFS
ENFVLPLSHDEVVHGKSSLIQKMPGDDWQQRASLRLLFSYMFSYPGAKLLFMGGEFGQRQ
EWSERRELDWYLLQYPEHQGLRKLVQDLNGLYRRYPALHRKSFTSEGFEWIDCHDSTQSV
ISFLRNPGTPEHGPLVIVANFTPIPRHHYRIGVPTGGNWQEIFNSDSTWYGGSNLGNPLL
LQAEPTPWMARPCSVELTVPPLGLVMLRPAT
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atggaaagccccgccctgagtgagttcgacctgcacctgtttgccgaaggcaggcattgg
cacatctacaatgtgctgggtgcccatcttgtaaatcaccgaggaaccgagggcacccgc
tttgccgtctgggcacccaacgcccgggcagtgagtgtgattggcgacttcaacaactgg
gacagcggccgtcatgccatggcggttaacaatggctatggtgtctggtccctatttatt
ccaggggtaaaagctggccatctatacaaatttgccataacaacccgaaacggccaccac
atcaccaaaaccgatccctatggtcaggcctttgagcaccggccttccaacgctgcagtg
gttaccgagcggggacactacgcctggggcgacggcgactggcttgagcgcagaaaccgg
ttcgactggcagcaaagtccaatctccgtctatgaggtgcatccgggctcctggcgacat
cacggttccgggcgttggttgacctaccgggagctcgccgatcagctggtgccctatgtg
ctggaaacgggcttcacgcatattgagctactcccggtgaccgaacacccgctggacgaa
tcctggggttaccagaccaccggctattacgcccccaccagccgatttggcagcccggat
gatctccgatacttcgtcgaccagtgccaccagaacaacatcggcgtgattctcgattgg
gtgcccggacatttccccgacgacgacttcgccctcgccgaattcgatggcacagcactt
tatgaacatgaagatccccgccgggggcgacaccaggattggggtacactcatctacaac
tacgggcgtcacgaagtccggaacttcctcataggcagtgcgcttttctggctggatacc
tttcacatggacgggctgcgggtggatgcggttgcttccatgctgtacctgaactactcc
cggaatgagggagaatggctgccgaacgaacatggcggccatgagaatctggacgcgatc
cggttccttcaggatctgaaccgggtatgccagagccggtttcccggcgtgctgatgatg
gcggaagagtccacgtcctggccccgggtgacgcggccgccggagattggcggtcttgga
ttcaatctgaaatggaacatgggatggatgcacgacaccttgcactacctgcaacaggac
cccgtgtatcgccagtatcaccacgacaagctcacctttggtttgctttatgccttttcg
gaaaatttcgtgctgccgctctcccacgacgaagtcgtacacggcaaatccagcctgatt
cagaaaatgccgggggatgactggcaacaaagagcctccctgcgcctattgttcagttac
atgttctcctaccccggtgcgaagctgctgttcatgggtggtgaatttggccagcgccag
gaatggagcgaacgtcgcgagctggactggtacctgctgcaataccccgagcaccagggg
ctgcgtaaacttgttcaggatctcaacgggctctatcgccgctacccggccctgcaccgc
aagagcttcaccagcgaaggcttcgagtggattgattgccacgattccacccagtctgtg
atcagttttctgcgcaacccgggaacgcccgagcatgggccgctggtgattgttgccaac
tttacccccatacccaggcatcactaccgcattggcgtgccaacaggaggtaactggcag
gaaatttttaattcagactccacctggtatggcggcagtaacctcggcaatcctctactc
ttgcaagctgagcccacaccctggatggcccgcccgtgttccgtggagcttacggtaccg
cccctgggcctggttatgctgaggccagcgacatga

DBGET integrated database retrieval system