KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_1435Help
Entry
Maqu_1435         CDS       T00454                                 

Definition
(GenBank) glycogen/starch synthase, ADP-glucose type
  KO
K00703  
starch synthase [EC:2.4.1.21]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:maq00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Maqu_1435
Enzymes [BR:maq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.21  starch synthase (glycosyl-transferring)
     Maqu_1435
Glycosyltransferases [BR:maq01003]
 Polysaccharide
  Storage polysaccharide
   Maqu_1435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1617012..1618478
Genome map
AA seq 488 aa AA seqDB search
MTRVLFATSEVFPLVKTGGLADVSASLPEALCRLGYDCQILLPGYPAALKAAREAGSRRK
TRFRYGQYDVSLWQTRLPGTAVTLWLVDCPALFDRAGDSPYQNEEGEDWWDNAHRFHLFG
RIGAMLALGQLGLAWRPDIVHCNDWQSALIPVFLADSQDAPKTVFTIHNLAYQGLFSHET
FRALGLPDSLWRYEFLEFHGQLSFIKGGLVFSDAITTVSPSYADEIQTPWFGNGLDGLLR
HKSSRLHGILNGIDTRQWNPEADPHLEFHYGADYPANKSQCQARLQQELGLEVCGAPLLG
FVGRLVEQKGLDWLLGVIKPLLERGCQFALLGSGEHHYQESLKAMVREWPGQCSLTLGYN
EGLAHRITAGADIFLMPSRFEPCGLNQMYSLRYGTVPVVHGVGGLNDTVFDPNEETPEQA
NGFVFREATPDALHAAITRALAAREDRKTWRKLQENGMKGDYSWKNRAGEYAALYRNLIA
GNDRIHED
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgacccgggtactgtttgccacgagcgaagtctttcctctggtaaaaaccggaggcctt
gcggatgtttcggcaagccttcctgaagctctctgccgcctgggctacgactgtcagatc
ctgctccccggctaccctgcagcgctgaaggctgcgcgggaggccggatcccgccggaaa
acccgatttcgctacggccagtatgatgtttccctgtggcaaacccgattgccgggcacc
gccgttaccctctggcttgtggattgcccagccctgttcgaccgtgctggcgacagccct
tatcagaacgaagaaggcgaggactggtgggacaacgctcaccggtttcatctgttcgga
cgaattggtgccatgttggcgctcgggcagctgggcctggcctggcggccggacatcgtg
cactgtaacgactggcaatccgcactgatcccggtgtttctggcagatagtcaggacgcc
ccgaaaaccgtgttcaccatccataatctcgcttaccaggggctgttttcccacgaaacc
tttcgtgccctgggcctgccggactcactttggcgatacgagttcctggagtttcacggc
caactgtcctttatcaaaggcggactggtgttcagcgatgccatcaccaccgtcagcccc
agctacgcagatgaaattcagacaccctggttcggtaacggtctggacggtttgctgcgc
cacaagtcatccaggcttcacggcattctcaatggtattgatacccgccaatggaacccg
gaagcggatccacacctggagttccactatggcgcggactatcccgccaacaaatcacaa
tgccaggcaaggctgcagcaggaactcgggctggaggtttgcggggctccattgctgggg
ttcgtcgggcgcctggtggaacagaaagggctggactggctgcttggggtcatcaagccg
ttgctggaacgaggatgtcagtttgccctgctcggctccggcgaacaccactaccaggaa
agcctgaaagccatggttcgtgaatggcccgggcaatgttcactcaccctcggttacaac
gaaggcctggcgcaccggataaccgccggggccgatattttcctgatgccttcccggttt
gaaccctgcggactgaaccagatgtacagcctgagatacggcaccgtacctgtggtgcac
ggcgtcggcggccttaacgatacggtgtttgaccccaatgaggaaacaccggaacaagcc
aatggctttgtgtttcgtgaggcgacgccagatgcattacatgccgccattacccgtgcg
ctggcagcgcgggaggaccggaaaacctggcgcaaactgcaggaaaacggcatgaaaggc
gactattcctggaagaaccgggccggcgaatacgcggccctgtaccggaacctcattgcc
ggcaacgaccggatacatgaagactga

DBGET integrated database retrieval system