KEGG   Marinobacter aquaeolei: Maqu_1472Help
Entry
Maqu_1472         CDS       T00454                                 

Definition
electron-transferring-flavoprotein dehydrogenase (EC:1.5.5.1)
Orthology
K00311  
electron-transferring-flavoprotein dehydrogenase [EC:1.5.5.1]
Organism
maq  Marinobacter aquaeolei
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1657397..1659049
Genome map
AA seq 550 aa AA seqDB search
MERESMEFDVLIVGGGPAGLSAACRVMQLAQEAGEELTVCVVEKGSEIGAHILAGTVFEP
TALNELFPDWKEKGAPLNTPVTRDDIFLLKNQEKATKVPNAFVPKNMHNHGNYIISLGNL
CRWLAEQAEQLGVEVYPGFAASETIVEDGQVKGIITGDMGVARDGSEKDGYMPGMELRAK
YTLFTEGCRGHLGKRLINDFKLDEGKDPQHYGIGIKELWDIDPAKHEPGLVVHTTGWPLN
ESGSTGGSFLYHLENGQVYVGLITDLSYSNPHLSPFEEFQRLKYHPEIKKYLEGGKRVAY
GARAIAKGGYNALPKMSFPGGLLLGCDAGTLNSSKIKGSHTAMKSGLLGAEAVFEALKEG
KSGEEITSFQKRFEDSWLYKELYAERNFGPAMHKFGNIVGGAIAFFEQNILRSSLPITFH
DTTPDYATLKPASECKKIDYPKPDNKLTFDRLSSVFISNTNHEEDQPVHLKLTDPEIPLK
ENLPKYDEPAQRYCPAGVYEVVEKDDGSGKKFQINAQNCVHCKTCDIKDPAQNITWVTPE
GGGGPNYPNM
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
gtggaacgcgaatcgatggaatttgatgttctgatcgtcggcggcggccctgcgggcctg
tcggcagcctgccgcgtcatgcaactggcgcaggaagccggcgaagaactgaccgtttgt
gtggttgaaaaaggttctgagatcggcgcgcacatcctcgccggcaccgtattcgagccc
acggccctgaacgaactcttcccggactggaaagagaaaggcgcccccctgaataccccg
gttacccgggacgacattttcctgctgaagaatcaggaaaaagccaccaaagtacccaat
gcctttgtgcccaagaacatgcacaaccacggcaactacatcatcagcctgggcaacctg
tgccgctggctggctgagcaggccgaacagctgggcgttgaagtgtatccgggctttgcc
gcctctgaaaccatcgttgaagatggtcaggtaaaaggcattatcaccggcgatatgggt
gttgcccgtgacggttccgagaaagacggctatatgccgggcatggaactgcgcgccaag
tacaccctgtttactgaaggctgtcgcggccatctgggcaagcgcctgatcaacgacttc
aagctggacgaaggcaaggatccgcagcactacggcatcggcatcaaagagctgtgggac
atcgacccggccaaacacgagccaggtctggttgttcacaccaccggctggccgttgaac
gaatctggctccaccggcggctctttcctgtatcacctggaaaacggtcaggtttatgtt
ggtctgatcaccgatctttcctacagcaacccgcacctcagcccgttcgaggagttccag
cgtctcaagtaccacccggaaatcaagaagtatctggaaggcggcaagcgtgttgcctac
ggcgcccgtgctatcgccaagggtggctacaatgccctgcctaagatgagcttcccgggc
ggcctgctgctgggttgtgatgccggcaccctgaacagctccaagatcaaaggctcccac
accgccatgaaatccggcctgttgggcgctgaagccgtattcgaggccctgaaggaaggt
aaatccggtgaggaaatcaccagcttccagaagcgtttcgaagacagctggctgtacaag
gagctttacgccgagcgtaactttggcccggccatgcacaagttcggcaatatcgtcggc
ggcgcgattgccttcttcgagcaaaacattctgcgcagcagcctgccgatcaccttccac
gacacgactccggactacgccaccctgaagccggcgtctgagtgcaagaagatcgactat
ccgaagccggataacaagctgacgtttgaccgcctgtcctcggtgttcatttccaacacc
aaccatgaggaagatcagccggttcacctgaagctgaccgacccggaaattccgctgaaa
gagaacctgccgaagtacgacgagccagcgcagcgttactgcccggctggcgtatacgaa
gtggtcgagaaagacgacggtagcggcaagaagttccagatcaatgcccagaactgtgtt
cactgcaagacctgtgacatcaaggatcctgcccagaacatcacctgggtaacgccggaa
ggcggcggtggtccgaactacccgaacatgtga

DBGET integrated database retrieval system