KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_1558Help
Entry
Maqu_1558         CDS       T00454                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
maq00260  Glycine, serine and threonine metabolism
maq00400  Phenylalanine, tyrosine and tryptophan biosynthesis
maq01100  Metabolic pathways
maq01110  Biosynthesis of secondary metabolites
maq01130  Biosynthesis of antibiotics
maq01230  Biosynthesis of amino acids
Module
maq_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:maq00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Maqu_1558
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Maqu_1558
Enzymes [BR:maq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Maqu_1558
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABM18642
UniProt: A1U0X3
Position
complement(1741602..1742822)
Genome map
AA seq 406 aa AA seqDB search
MSVKLTEEMLKALPDARGHFGAFGGRFVSETLMDSLMTLEKEYLRLKEDPEFQATFDNDL
ADYVGRPSPLYFAERLTREAGGAQIWLKREDLNHTGAHKVNNTIGQALLASFLGKKRIIA
ETGAGQHGVATATVCARLGLECHVFMGAEDVKRQSLNVYRMKLLGATVHAVQSGTKTLKD
AMNDAMRDWVANVDDTFYIIGTVAGPHPYPLLVRDFQSVIGREIRKQAMEKVGKLPDALV
ACVGGGSNAIGMFYPFLADESVELYGVEAGGLGIETGQHAAPLCAGRPGVLHGNRTYLME
DENGQIAGTHSVSAGLDYPGVGPEHAWLKDIGRANYVSVTDDEALDGFRKLTRVEGIMPA
LETAHAVAYGVKLAATMDKDKMLVINISGRGDKDIHTIAQLDGIEI
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgtaaaactgactgaagaaatgttgaaggcgcttcctgatgcgagaggtcacttc
ggtgcctttggtggacggtttgtttcagaaaccctgatggattctctgatgaccctggaa
aaggagtaccttcggttgaaggaggatccggaattccaggcgacttttgacaatgacctc
gccgattatgttggccgtcccagcccgctctatttcgcagagcgcctgacccgggaagcc
ggtggcgcacaaatctggctcaagcgtgaagacctcaaccataccggtgcccataaggtg
aataacaccattggccaggccctgctggccagttttctgggcaaaaagcgcatcattgcc
gaaactggcgccggtcaacatggtgtggccaccgccacggtgtgtgcccgtctgggcctt
gaatgtcacgtattcatgggggcagaagacgtcaagcgtcagtccctgaacgtctaccgt
atgaaactgctgggcgcgaccgtccacgccgtccagagcggtacgaaaacccttaaggac
gccatgaatgatgccatgcgcgactgggtcgcgaatgtggatgatactttctacatcatc
ggcacagtggcagggccgcatccctaccccttactggtgcgtgatttccagtcggtgatt
gggcgtgaaatccgtaaacaggccatggaaaaagtgggtaaactgccggacgcactggtg
gcctgcgtcggtggcggttctaacgccattggtatgttctatccgttcctcgcggatgaa
tccgtggaactttatggtgttgaagccggtggtctgggtattgaaactggccaacatgcc
gcgccgctttgtgccgggcgccccggtgtgctgcatggtaaccggacctatctgatggaa
gatgagaatggccagatcgccggaacgcattccgtcagtgctggtctggactaccccggg
gtcggccccgaacatgcctggttgaaagacatcggccgagccaattacgtgtcggtgact
gatgacgaggccctggatggcttccgtaaactgacacgcgtggaggggattatgccagca
ctggaaaccgcccatgccgtggcttatggcgtgaagctcgccgcaaccatggacaaggac
aaaatgctggtgatcaacatctccggtcgcggcgacaaggatattcacaccattgcccag
cttgatggcattgagatctga

DBGET integrated database retrieval system