KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_1615Help
Entry
Maqu_1615         CDS       T00454                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
maq00010  Glycolysis / Gluconeogenesis
maq01100  Metabolic pathways
maq01110  Biosynthesis of secondary metabolites
maq01120  Microbial metabolism in diverse environments
maq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:maq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Maqu_1615
Enzymes [BR:maq01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Maqu_1615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ABM18699
UniProt: A1U130
Position
1809210..1810130
Genome map
AA seq 306 aa AA seqDB search
MSDSSSKPPATGGPGNWSFTRWSTIGQLEALEVHHPLFQATLFLQGAHLTHFAPMDERNW
LWLSELARFQPGRAIRGGIPVCWPWFGDPLRNPPEIRKRIASSSAHGFARTALWRLEDVR
ESAHEVEVSLSLSANDDFQEHWDGHALALITFSFSIRGCQIALTTTNLSKAPLAFSQALH
TYLPTDDIQRTRVLGLGNSQYIDTLKDWDYVSQEGPVYFEGEVDRIYETGEALTVVTPSG
KRKLTSVGSDSTVVWNPGPGKAQRLSDFPDSAWQKMLCVETANAASDYRVLNEGQSHTLG
VFIGRA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacagcagtagcaagccgccagcaaccggaggcccgggcaactggtcatttacc
cgctggagtaccatcgggcaactggaggcacttgaagttcatcacccattgttccaggcc
acgttgtttctacagggggcacacctcacccatttcgcgccaatggatgaacgcaactgg
ctctggctcagtgaactcgcccgttttcaacctggccgagcaattcgcggtggcattccc
gtgtgctggccctggtttggagacccactccggaacccgccggaaatccgcaagcgcata
gcgtcatcctcagcccatggctttgcccgcaccgctttatggcggctggaagatgttcgg
gaaagcgcccacgaggtagaagtcagcctgtccctcagcgccaacgacgatttccaggaa
cactgggacggccacgccctggccctgatcaccttcagtttttccattcgcggttgccag
atcgcactgacaaccaccaatctttcgaaagcgccgctggcgttcagccaggcccttcac
acttacctgcccactgacgacattcagcgaacccgcgtgctgggcctgggaaacagccag
tacatcgacacgctgaaagactgggactacgtctcacaggaagggccagtgtatttcgaa
ggtgaagtggaccggatatacgaaaccggcgaagcactgaccgtagtaacaccttccggc
aagcgaaagcttacgtctgtgggtagcgattcaaccgtggtctggaacccgggcccggga
aaagcgcagcgtctttctgattttccagactctgcctggcagaaaatgctgtgcgtcgaa
acagccaatgcagcatcggattatcgggtattaaatgaaggccagagccacacactgggc
gtattcatcggccgcgcctga

DBGET integrated database retrieval system