KEGG   Marinobacter aquaeolei: Maqu_1636Help
Entry
Maqu_1636         CDS       T00454                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
maq  Marinobacter aquaeolei
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:maq00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1834699..1836630)
Genome map
AA seq 643 aa AA seqDB search
MCGFAGFVNTKPFSDAEHVLEQMGRAIEHRGPDGAGTWYDHSLSVGLSHRRLSIIDLSEY
GAQPMASASGRFVVAFNGEIYNFRQLRKEMEAQGAQFRGHSDTEVMLAAFEAWGVEPALQ
RLSGMFAFVLVDKRFRKLYLARDRMGEKPLYYGWQGESLLFGSELRALRQHPDWQGAIDT
SVLPALLRHNVIPAPRTIHQGICKLPPASYVCLDLDHPQSGQLPETKRYWKLESCFEERS
GFTLESAADELERLLKQSISDQMVSDVPLGAFLSGGIDSSTVVGIMQSMASQPVRTFSIG
FREEGFNEAEHAAAVAKHLGTDHTELYVTEQEARDLVPNIPVIYDEPFADSSQIPTFLVS
QMTRKHVTVALSGDGGDELFCGYTRYPGMLNAWNSRSSAAGRLKRIAASLPPGLSARLIR
ALVHSQRHRSVEAIQYQLCRIRSIAEASDLSEFYRRSVSLWPDPAIALKVAGDYGYGLNS
ALAGGVPDNTLKTLMWRDLNWYLPDDILTKVDRAAMACSLETRIPMLAPEIVSFALGLPD
TLNLQGGVGKQVLRSVLYRYVPRNLIDRPKQGFAVPVAAWLRGALREWAEELLAEHRLAQ
QAYWHTGMVRWMWKEHLSGREDYSFELWGILMFQAWLNEYQRG
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggttttgccggatttgttaacacgaaacccttttcggatgcggagcatgttcta
gagcagatgggtcgtgccatcgagcatagagggcccgatggtgcgggaacttggtatgac
cacagtttgtccgtcggcctgagtcaccgtcgcctgtcgattatcgatctttccgagtat
ggcgcccagccgatggcgtcggcgtccggccggtttgttgttgcattcaatggcgagata
tataactttcgccagctacgtaaagagatggaagctcaaggcgcgcaatttcgggggcat
tcagataccgaagtcatgcttgcagcattcgaggcctggggggtcgaaccggctctccag
cgactttcagggatgttcgcctttgtgttagtggacaagcggttccgtaaactttatctg
gcaagggaccgaatgggggaaaagcccctgtactatggctggcagggtgaaagcctgctt
tttggttcagagcttcgggcattacgccaacatcccgattggcagggggcaattgataca
tccgtcctgcctgcacttctgcgccacaatgtgattccggcacctcgcaccatacaccag
ggtatatgcaagctaccgccggcctcttatgtgtgcctcgatctggatcaccctcagtcc
ggtcagctaccggagaccaaacgttattggaagctggaatcctgctttgaggagcggtcg
gggttcacgttagaaagtgctgccgatgagctcgaaaggctactgaagcagtcaatcagt
gaccaaatggtgtctgatgtaccgctcggtgcttttttgtccggtggcatcgactcatct
accgtggttggcatcatgcagagcatggccagtcagccagtacgtaccttcagtattggt
tttcgtgaagaaggcttcaatgaggcagaacatgcagcggcggtcgcgaagcatcttggt
acggaccataccgagctttatgtgactgagcaggaagccagagacttggttccgaacatc
cctgtaatttacgatgaaccctttgcggactcctcgcagattcccacatttctggttagt
cagatgacgcgtaagcatgtcacggtggctctatccggcgatggcggcgacgagttgttc
tgtggctatacccgttatcctggcatgctgaatgcgtggaatagccggtcatcggctgct
ggtcgtcttaagcgtattgctgctagtttaccaccggggctgtctgcccggctgatccgc
gctctggtgcattcccagaggcatcgaagcgtagaagcaatccagtatcagctgtgcaga
attcgatcgattgctgaagcctccgatctttctgaattttaccgccggtcggtgtccctt
tggccagaccctgccatagcgctgaaggtggcaggggattatggttatggattgaacagt
gcacttgctggaggtgtcccggataatacgctcaagaccctgatgtggcgggatcttaac
tggtatctgccagatgacatcttgaccaaagtggatcgcgcggctatggcatgtagcctg
gaaacccgtattccaatgttggctccggaaattgtgtccttcgcactggggctgcccgat
accctcaatctgcaaggcggcgttggcaagcaggttcttaggtctgtgctataccgttat
gtaccgcggaaccttattgaccgtcccaagcagggattcgctgtaccggtcgcggcttgg
ttgagaggcgcactccgggagtgggcggaggagctactggccgagcatcggctcgctcag
caagcatactggcatacgggaatggtgcgctggatgtggaaggagcatctttctggccgg
gaagattatagttttgagctttggggcattttgatgttccaggcttggcttaacgagtac
caaaggggatga

DBGET integrated database retrieval system