KEGG   Marinobacter aquaeolei: Maqu_1672Help
Entry
Maqu_1672         CDS       T00454                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase GalU
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:maq00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Maqu_1672
   00052 Galactose metabolism
    Maqu_1672
   00500 Starch and sucrose metabolism
    Maqu_1672
   00520 Amino sugar and nucleotide sugar metabolism
    Maqu_1672
Enzymes [BR:maq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Maqu_1672
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1878982..1879818
Genome map
AA seq 278 aa AA seqDB search
MIKKCLFPVAGYGTRFLPATKAMPKEILPIVNKPLVQYGVEEAADAGIHEFGFVTGRGKR
AIEDHFDISYELEHQIAGTGKEGLLTSIRDLINNNSFAFTRQNEMKGLGHAILTGRNLVG
DNPFAVVLADDFCVGPEDGDGVLTQMVKLYNQFRCSIVAIEEVPEDETHKYGVIAGESMK
DGLYRITDMVEKPAPEDAPSNLAIIGRYILTPDIFDIIERTPPGKNGEVQITDALLEQAK
NGCVLAYQFKGQRFDCGSIDGFVEATNFVYENIYKKGK
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaagtgcctcttcccggttgccggatacggcacccgtttccttccggccacc
aaggccatgcccaaggaaattctgccgatcgttaacaagccactggtgcagtacggggtg
gaggaagccgcagatgccggcattcatgaattcggctttgtcaccggccgcggcaaacgc
gccatcgaagatcattttgatatcagttacgagctcgagcaccagattgccggtaccggc
aaggaaggcctgcttacctctatccgggatctgatcaacaacaattcttttgccttcacc
cgtcagaatgaaatgaagggactgggccacgccatcctgactggccgcaacctggtgggc
gacaacccgttcgcggttgtgctcgcggatgacttctgcgtgggcccggaagatggtgac
ggcgttctgacccagatggtcaaactgtataaccagttccgctgttccattgtggccatc
gaagaagtaccggaagacgaaacccacaagtacggtgtgattgcgggtgaatccatgaag
gatggcctttaccgtattaccgacatggtggagaaaccagcaccggaagacgcgcccagc
aacctggcgattatcggccgctacattctgaccccggacattttcgacattatcgagcgt
acgccgccgggtaagaatggtgaggttcagattaccgatgccctgctggagcaggcgaag
aatggttgcgtgctggcctaccagtttaaaggtcagcgttttgactgcggcagcattgac
ggtttcgtggaggccaccaacttcgtttacgagaacatctacaagaagggaaaatag

DBGET integrated database retrieval system