KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_1672Help
Entry
Maqu_1672         CDS       T00454                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
maq00040  Pentose and glucuronate interconversions
maq00052  Galactose metabolism
maq00500  Starch and sucrose metabolism
maq00520  Amino sugar and nucleotide sugar metabolism
maq01100  Metabolic pathways
maq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:maq00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Maqu_1672
   00052 Galactose metabolism
    Maqu_1672
   00500 Starch and sucrose metabolism
    Maqu_1672
   00520 Amino sugar and nucleotide sugar metabolism
    Maqu_1672
Enzymes [BR:maq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Maqu_1672
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ABM18756
UniProt: A1U187
Position
1878982..1879818
Genome map
AA seq 278 aa AA seqDB search
MIKKCLFPVAGYGTRFLPATKAMPKEILPIVNKPLVQYGVEEAADAGIHEFGFVTGRGKR
AIEDHFDISYELEHQIAGTGKEGLLTSIRDLINNNSFAFTRQNEMKGLGHAILTGRNLVG
DNPFAVVLADDFCVGPEDGDGVLTQMVKLYNQFRCSIVAIEEVPEDETHKYGVIAGESMK
DGLYRITDMVEKPAPEDAPSNLAIIGRYILTPDIFDIIERTPPGKNGEVQITDALLEQAK
NGCVLAYQFKGQRFDCGSIDGFVEATNFVYENIYKKGK
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaagtgcctcttcccggttgccggatacggcacccgtttccttccggccacc
aaggccatgcccaaggaaattctgccgatcgttaacaagccactggtgcagtacggggtg
gaggaagccgcagatgccggcattcatgaattcggctttgtcaccggccgcggcaaacgc
gccatcgaagatcattttgatatcagttacgagctcgagcaccagattgccggtaccggc
aaggaaggcctgcttacctctatccgggatctgatcaacaacaattcttttgccttcacc
cgtcagaatgaaatgaagggactgggccacgccatcctgactggccgcaacctggtgggc
gacaacccgttcgcggttgtgctcgcggatgacttctgcgtgggcccggaagatggtgac
ggcgttctgacccagatggtcaaactgtataaccagttccgctgttccattgtggccatc
gaagaagtaccggaagacgaaacccacaagtacggtgtgattgcgggtgaatccatgaag
gatggcctttaccgtattaccgacatggtggagaaaccagcaccggaagacgcgcccagc
aacctggcgattatcggccgctacattctgaccccggacattttcgacattatcgagcgt
acgccgccgggtaagaatggtgaggttcagattaccgatgccctgctggagcaggcgaag
aatggttgcgtgctggcctaccagtttaaaggtcagcgttttgactgcggcagcattgac
ggtttcgtggaggccaccaacttcgtttacgagaacatctacaagaagggaaaatag

DBGET integrated database retrieval system