KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_1713Help
Entry
Maqu_1713         CDS       T00454                                 

Definition
alcohol dehydrogenase
Orthology
K18369  
alcohol dehydrogenase [EC:1.1.1.-]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:maq00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Maqu_1713
Enzymes [BR:maq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     Maqu_1713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1916769..1917800
Genome map
AA seq 343 aa AA seqDB search
MKALVFHGPGKRSWEDKPQPAIEKPTDAVVRITHTTICGTDLHILKGDVPAVTKGRTLGH
EGVGVVEEVGDGVSNIKVGDKVLISCVTSCGRCDYCKRGIYAHCRDGGWILGHLIDGTQA
EYVRIPHADNSLYHLPSGMDPAAAVMLSDILPTGHEIGALAGEVKLGDTVAIIGAGPIGL
AAVMTSRFYSPARIIMIDPDENRLAMARMLGATDTIARDPIETIKELTNGEGVDVAMEAV
GIPETFDICQSIIRAGGNIANIGVHGKSVEFRLQDLWIKNITVRTGLVSTNTIPVLMKVV
ESGDVKPEDLVTHRLKLNDIEKAYDIFSQAAKEKAVKMLLTAE
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattggtatttcacggaccaggaaagcgtagctgggaagacaagccacagcct
gcaatcgagaaacccacagatgccgtggtgcgcatcacccataccaccatttgcggcacc
gacctgcacatcctgaaaggcgatgtgccagcggtcacgaaaggtcgcactctcggccac
gaaggcgtgggagtggtcgaagaagtgggtgacggagtaagtaacatcaaggttggcgac
aaagtgttgatttcctgcgtcacctcctgcgggcgttgcgactactgtaagcgcggcatc
tatgcccactgccgggacggcggctggattctggggcatttgatcgatggcacccaggcc
gagtatgtacgcatcccccatgccgacaacagcctgtaccacctgccttcaggaatggac
ccagctgccgcggtgatgctcagcgacatcctgcccacaggacacgagattggcgctctc
gccggcgaagtcaaactgggggacacagtcgccatcatcggcgccggccccatcggactg
gccgccgtaatgacctcccgcttctactcaccggcgcgtatcatcatgattgatccggac
gagaaccgcctggcaatggccaggatgctgggggccacagacaccatcgcccgagacccc
atcgaaaccatcaaagaactgaccaacggtgagggtgtagacgttgccatggaggcggtc
ggcatacctgagaccttcgatatctgccagagcatcattcgcgctggcggcaacatcgcg
aacatcggcgtacacggcaaaagcgtggaattccggctgcaggacctgtggatcaaaaac
atcacggtacgcaccggcttggtgagcaccaacaccattccggtgctgatgaaggtcgtc
gagagtggcgatgtgaagccggaggacctggtcacacaccgcctcaagctcaacgatatc
gaaaaagcctacgacatcttcagccaggcggcgaaggagaaagcagtcaagatgttgctg
accgccgaatga

DBGET integrated database retrieval system