KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_1713Help
Entry
Maqu_1713         CDS       T00454                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K18369  alcohol dehydrogenase [EC:1.1.1.-]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
maq00640  Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:maq00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Maqu_1713
Enzymes [BR:maq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     Maqu_1713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ABM18797
UniProt: A1U1C8
Position
1916769..1917800
Genome map
AA seq 343 aa AA seqDB search
MKALVFHGPGKRSWEDKPQPAIEKPTDAVVRITHTTICGTDLHILKGDVPAVTKGRTLGH
EGVGVVEEVGDGVSNIKVGDKVLISCVTSCGRCDYCKRGIYAHCRDGGWILGHLIDGTQA
EYVRIPHADNSLYHLPSGMDPAAAVMLSDILPTGHEIGALAGEVKLGDTVAIIGAGPIGL
AAVMTSRFYSPARIIMIDPDENRLAMARMLGATDTIARDPIETIKELTNGEGVDVAMEAV
GIPETFDICQSIIRAGGNIANIGVHGKSVEFRLQDLWIKNITVRTGLVSTNTIPVLMKVV
ESGDVKPEDLVTHRLKLNDIEKAYDIFSQAAKEKAVKMLLTAE
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattggtatttcacggaccaggaaagcgtagctgggaagacaagccacagcct
gcaatcgagaaacccacagatgccgtggtgcgcatcacccataccaccatttgcggcacc
gacctgcacatcctgaaaggcgatgtgccagcggtcacgaaaggtcgcactctcggccac
gaaggcgtgggagtggtcgaagaagtgggtgacggagtaagtaacatcaaggttggcgac
aaagtgttgatttcctgcgtcacctcctgcgggcgttgcgactactgtaagcgcggcatc
tatgcccactgccgggacggcggctggattctggggcatttgatcgatggcacccaggcc
gagtatgtacgcatcccccatgccgacaacagcctgtaccacctgccttcaggaatggac
ccagctgccgcggtgatgctcagcgacatcctgcccacaggacacgagattggcgctctc
gccggcgaagtcaaactgggggacacagtcgccatcatcggcgccggccccatcggactg
gccgccgtaatgacctcccgcttctactcaccggcgcgtatcatcatgattgatccggac
gagaaccgcctggcaatggccaggatgctgggggccacagacaccatcgcccgagacccc
atcgaaaccatcaaagaactgaccaacggtgagggtgtagacgttgccatggaggcggtc
ggcatacctgagaccttcgatatctgccagagcatcattcgcgctggcggcaacatcgcg
aacatcggcgtacacggcaaaagcgtggaattccggctgcaggacctgtggatcaaaaac
atcacggtacgcaccggcttggtgagcaccaacaccattccggtgctgatgaaggtcgtc
gagagtggcgatgtgaagccggaggacctggtcacacaccgcctcaagctcaacgatatc
gaaaaagcctacgacatcttcagccaggcggcgaaggagaaagcagtcaagatgttgctg
accgccgaatga

DBGET integrated database retrieval system