KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_1829Help
Entry
Maqu_1829         CDS       T00454                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:maq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Maqu_1829
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Maqu_1829
   00052 Galactose metabolism
    Maqu_1829
   00500 Starch and sucrose metabolism
    Maqu_1829
   00520 Amino sugar and nucleotide sugar metabolism
    Maqu_1829
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Maqu_1829
   00524 Butirosin and neomycin biosynthesis
    Maqu_1829
Enzymes [BR:maq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Maqu_1829
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2037580..2038545)
Genome map
AA seq 321 aa AA seqDB search
MTAEHYSLVGDIGGTNARFALVKQGSIEPEAIEVLPCRDYENLDQAVVTYLERVGVASVR
QACLAVASPLRGTRVTMTNNHWRFDIEAVRQVFGWSAFKVINDFTAMALGVPHVSDANLV
HVCGGPGDPGRPKLVMGPGTGLGVSGLVPIRNGWVPLVTEGGHVDFAPTDDTEMDVLRLL
RARFGRVSVERILCGQGLLNLYQAHAEIRGVAAPLDAPEKITAAAVDASDALAGEVLQHF
CEMLGRTAGNSALTLGSLGGVYLCGGMLPGFLDFFLGSPFREAFVAKGRMRPLMEFTPVY
VVTEPYTGLLGAAEALGNSEV
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacagcagaacactattctctggtgggggacattgggggaaccaatgcacgctttgct
ctggtgaagcagggcagtatagaaccagaagctattgaagttttgccctgccgtgattac
gagaacctggatcaggcggtggtcacctatctggaacgtgtaggtgtggcgtcggtcagg
caggcctgtctggccgtggcctcccccttgcgcggtacccgggtgacaatgaccaacaat
cactggcgctttgacattgaggcggtgcgacaggtctttggctggtcggccttcaaggtc
atcaatgattttaccgccatggcgctgggcgtgccccatgtatcggacgctaatctggtg
cacgtttgtggcggcccgggagaccctggccggccgaaactggtgatgggtccgggaacg
ggcctgggcgtttccggtctggttccgattcgaaatggctgggtgcctttggtgactgaa
gggggccatgtggattttgcccccaccgatgacacggaaatggacgtgttgcgccttctc
cgggccaggtttgggcgggtgtcggtcgagcggattctgtgcggccagggtttgctgaac
ctgtatcaggcccatgccgaaatccgtggcgtggcggccccactcgatgctccggagaag
atcacagccgccgctgtggacgcttccgatgccttggccggggaagtccttcagcatttc
tgcgaaatgcttgggcgaaccgcaggcaattcggcgctgacgctggggagtctgggcggc
gtgtacctgtgtggcggtatgctgccagggtttctcgacttttttcttgggagcccgttc
cgtgaagcctttgtagccaaggggcggatgcgtccgctaatggaatttacaccggtttac
gtggtgacggagccctataccggtttactgggagctgccgaagcgttaggaaattccgag
gtatga

DBGET integrated database retrieval system