KEGG   Marinobacter aquaeolei: Maqu_1843Help
Entry
Maqu_1843         CDS       T00454                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
maq  Marinobacter aquaeolei
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:maq01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:maq00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:maq00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2056642..2058822)
Genome map
AA seq 726 aa AA seqDB search
MTERVQVGGIQIAKNLYDFVNNEAIPGTGIEADKFWAEFDKIVNELAPRNRELLLKRDEI
QEKMDTWNREHKGQKLDMAEYKAFLKDIGYLVDEPADFKISTSNVDPEIATMAGPQLVVP
VMNARFALNAANARWGSLYDALYGTDAISEENGAEKGRGYNPVRGAKVIEWARNLLDGSA
PLASGSHKDAAKYYIDGGKLAVKLQNGDVTGLKDESGFVGYTGAADAPTGVLLVKNGMHF
EIQIDASHPIGKDDGAHVKDVLMESALTTIMDCEDSVAAVDADDKVVAYKNWLGLMKGDL
EESFEKGGQMMTRRMNGDRTYTGADGSELTLKGRSLLFVRNVGHLMTNPAILLKDGSEIP
EGLMDGLVTSLIAIHDLKGDGKFQNSTKGSVYIVKPKQHGPEEVAFTNEFFGRVEDALGL
PRFTLKVGIMDEERRTTVNLKACIHAAKERTVFINTGFLDRTGDEIHTSMELGPFIRKGP
MKQAAWINAYEQWNVDIGLEAGLSGVAQIGKGMWAMPDLMAGMLEAKIGHPKAGANTAWV
PSPTAATLHATHYHQVNVFDVQKELANRQRASLDDILTVPVMEDPSSLSAEDIQQELDNN
AQGILGYVVRWIDQGVGCSKVPDINDVGLMEDRATLRISSQLLTNWLYHGICSEEQIMET
MKRMAAVVDKQNAGDAAYRNMAPNFDDSIAFQAAVDLVLKGREQPAGYTEPLLHAYRQKA
KAKYGQ
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgacagaacgcgttcaagttggcggcatccagatcgccaagaatctgtacgattttgta
aataacgaagcgattccgggcaccggtattgaagctgacaagttctgggccgagttcgac
aagatcgtgaacgagctcgctccgcgcaatcgcgagctgctgctcaagcgtgacgaaatc
caggaaaaaatggatacctggaaccgcgagcacaagggccagaaactggacatggccgag
tacaaggcgtttctgaaagacatcggctacctggtagatgagccggcggatttcaaaatc
tccacctccaatgtggatccggaaatcgccaccatggccggcccgcagctggttgtgccg
gtcatgaatgcccgtttcgccctgaacgcggctaacgctcgctggggtagcctgtacgat
gccctgtacggtaccgacgctatttctgaggaaaacggtgctgagaagggccgtggctac
aacccggttcgtggcgccaaggtgattgagtgggcccgcaacctgctggatggctctgcg
cctctggcttccggtagccataaagacgccgcaaaatactatatcgacggcggcaagctg
gcggttaaacttcagaacggtgacgtgaccggtctgaaagacgagtccggttttgtgggt
tacaccggcgctgccgatgcccccactggcgttttgctggtgaagaatggcatgcatttc
gaaatccagattgatgccagccatccgatcggcaaggatgacggtgcccacgttaaagac
gttctgatggaatcggccctgaccaccatcatggactgcgaagactcagttgccgcggta
gatgctgatgacaaggttgtcgcctacaagaattggcttggcctgatgaagggcgatctg
gaagagtccttcgagaagggcggccagatgatgactcgtcgcatgaatggcgaccgcacc
tacactggcgccgatggcagcgagctgaccctcaagggccgcagcctgctgttcgttcgt
aacgttggccacctgatgactaacccggccattctgctgaaggatggtagcgaaatcccc
gagggtctgatggacggcctggtaacatccctgatcgccatccacgacctgaagggcgac
ggcaaattccagaacagcaccaagggttctgtgtacattgttaagcccaagcagcacggc
ccggaagaagtggcgttcaccaatgaattcttcggtcgtgttgaagacgctcttggtctg
ccgcgcttcaccctgaaagtgggcatcatggacgaagagcgtcgcaccaccgtgaacctg
aaggcctgcatccacgctgccaaagagcgcaccgtgtttatcaataccggcttcctggat
cgcaccggtgatgagattcatacatccatggagttgggtcccttcatccgtaaggggccg
atgaagcaggctgcctggatcaacgcttacgagcagtggaacgttgacatcggcctggaa
gccggtctgtctggcgttgcccagattggtaagggtatgtgggccatgccggatctgatg
gcaggcatgctggaggccaagatcggtcatccgaaggctggtgccaacaccgcctgggtt
ccgtctccgacagccgctaccctgcatgccactcactaccaccaggtgaacgtgtttgat
gtgcagaaagagctggctaaccgtcagcgcgcgtctctggacgacatcctgactgtgccg
gtgatggaggatccgtcgtccttgagcgccgaggacattcagcaggaactggacaacaac
gcccagggtatccttggctacgttgtacgttggatcgaccagggtgtgggctgctccaag
gtgcctgacatcaacgatgtgggcctgatggaagaccgtgcgacactgcgtatttcttcg
cagctgctgaccaactggctgtaccacggcatctgctctgaagagcagatcatggaaacc
atgaagcgcatggctgcggttgttgataagcagaacgctggtgatgcggcgtatcgcaac
atggctccgaactttgacgacagcattgccttccaggccgctgtggatctggttctgaag
gggcgcgaacagccggccggctacacagagccgctgctgcacgcataccgtcagaaggcc
aaggccaaatacgggcagtaa

DBGET integrated database retrieval system