KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_1971Help
Entry
Maqu_1971         CDS       T00454                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:maq00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Maqu_1971
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Maqu_1971
Enzymes [BR:maq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Maqu_1971
Two-component system [BR:maq02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Maqu_1971
Bacterial motility proteins [BR:maq02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Maqu_1971
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2198611..2199756)
Genome map
AA seq 381 aa AA seqDB search
MTVSVLVVDDSGFFRKRLTEILTASGQIKVVGAATNGREGVELAEKLRPDVITMDYEMPV
MDGISAVREIMRKHPTPVLMFSSLTYEGARVTLDALEAGAVDFLPKNFEEIARDTSQLQK
ILIQRILDVAGSRPGARSAPVAPRPAAPAAEPRREPVERAGSRLHRPVTTEPRKDPATSE
PVRKPARKTAARHYSVVAIGTSTGGPVALQKVLTALPASFPAPIVLVQHMPASFTPAFAE
RLNKLCRIEVRQAEDGDVLRPGLALLAPGGKQMMIESRGGQAKVRILPGDDRLNYKPCVD
VTFGSLARSFPGKTLGLILTGMGSDGKEGCRMMKQSGSVIWSQDEKSSVIYGMPMAVAKA
GLSDEILALEDIGARLVEGVS
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgacagtttctgtcctggtcgtggatgattcgggcttttttcgcaaacggctgacggaa
atcctgacggcctcgggccagattaaagtggtaggcgccgccaccaacgggcgggaaggt
gtcgagctggcagaaaaactgcgccccgatgtgatcaccatggattacgagatgccggtg
atggacggcatctctgccgtgcgcgagatcatgcgcaaacatcccaccccggttttgatg
ttctcgtccctgacctatgaaggtgcccgcgttaccctggatgccctggaagccggggca
gtggatttcctgcccaagaacttcgaggaaattgccagggacaccagtcaacttcagaaa
atccttatccagcgtattctggatgtggccggtagccgcccgggtgcccgatcggcgcct
gtggccccgaggccggcggcaccggctgcggaacctcgccgtgaacctgtcgagcgcgcc
ggttcgcgcctgcaccgcccggtaacgacggaaccccgtaaagaccctgcgacctccgag
ccggttcgtaaacccgccagaaaaacggccgccaggcactacagtgtggtagccatcggc
acttccaccggtggccccgttgcgctgcaaaaggtgctaacggcgttaccggcttcgttt
cccgcgcccatcgtgttggttcagcacatgcccgccagcttcactccggcctttgccgag
cggctcaacaagttgtgtcgcattgaggtgcgccaggccgaggacggcgacgtgcttcgt
ccgggactggccctgctggcgcccggtggcaagcagatgatgattgaaagtcgcggcggg
caggcaaaagtgcggattcttccgggcgatgaccgcttgaattacaaaccctgtgtggat
gttaccttcggctctctggccaggagcttcccaggcaaaaccctgggcctgatcctcact
ggtatgggttccgacggcaaggaaggctgcaggatgatgaagcagtccggttccgtgatc
tggtcccaggatgagaaatcctccgtcatctatggcatgccgatggctgtggccaaagcc
ggactgagcgacgagattctggcgctggaggatattggcgcgcggctggttgaaggtgtg
agctga

DBGET integrated database retrieval system