KEGG   Marinobacter aquaeolei: Maqu_1971Help
Entry
Maqu_1971         CDS       T00454                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
maq  Marinobacter aquaeolei
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:maq02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:maq02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2198611..2199756)
Genome map
AA seq 381 aa AA seqDB search
MTVSVLVVDDSGFFRKRLTEILTASGQIKVVGAATNGREGVELAEKLRPDVITMDYEMPV
MDGISAVREIMRKHPTPVLMFSSLTYEGARVTLDALEAGAVDFLPKNFEEIARDTSQLQK
ILIQRILDVAGSRPGARSAPVAPRPAAPAAEPRREPVERAGSRLHRPVTTEPRKDPATSE
PVRKPARKTAARHYSVVAIGTSTGGPVALQKVLTALPASFPAPIVLVQHMPASFTPAFAE
RLNKLCRIEVRQAEDGDVLRPGLALLAPGGKQMMIESRGGQAKVRILPGDDRLNYKPCVD
VTFGSLARSFPGKTLGLILTGMGSDGKEGCRMMKQSGSVIWSQDEKSSVIYGMPMAVAKA
GLSDEILALEDIGARLVEGVS
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgacagtttctgtcctggtcgtggatgattcgggcttttttcgcaaacggctgacggaa
atcctgacggcctcgggccagattaaagtggtaggcgccgccaccaacgggcgggaaggt
gtcgagctggcagaaaaactgcgccccgatgtgatcaccatggattacgagatgccggtg
atggacggcatctctgccgtgcgcgagatcatgcgcaaacatcccaccccggttttgatg
ttctcgtccctgacctatgaaggtgcccgcgttaccctggatgccctggaagccggggca
gtggatttcctgcccaagaacttcgaggaaattgccagggacaccagtcaacttcagaaa
atccttatccagcgtattctggatgtggccggtagccgcccgggtgcccgatcggcgcct
gtggccccgaggccggcggcaccggctgcggaacctcgccgtgaacctgtcgagcgcgcc
ggttcgcgcctgcaccgcccggtaacgacggaaccccgtaaagaccctgcgacctccgag
ccggttcgtaaacccgccagaaaaacggccgccaggcactacagtgtggtagccatcggc
acttccaccggtggccccgttgcgctgcaaaaggtgctaacggcgttaccggcttcgttt
cccgcgcccatcgtgttggttcagcacatgcccgccagcttcactccggcctttgccgag
cggctcaacaagttgtgtcgcattgaggtgcgccaggccgaggacggcgacgtgcttcgt
ccgggactggccctgctggcgcccggtggcaagcagatgatgattgaaagtcgcggcggg
caggcaaaagtgcggattcttccgggcgatgaccgcttgaattacaaaccctgtgtggat
gttaccttcggctctctggccaggagcttcccaggcaaaaccctgggcctgatcctcact
ggtatgggttccgacggcaaggaaggctgcaggatgatgaagcagtccggttccgtgatc
tggtcccaggatgagaaatcctccgtcatctatggcatgccgatggctgtggccaaagcc
ggactgagcgacgagattctggcgctggaggatattggcgcgcggctggttgaaggtgtg
agctga

DBGET integrated database retrieval system