KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_2109Help
Entry
Maqu_2109         CDS       T00454                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2362115..2364007)
Genome map
AA seq 630 aa AA seqDB search
MTPETHMPRLFVLFSLLCCLLAPSLSSAESVEWGQFSKRLELSRFVDYWKEEGARSIEDV
RGLPAQAWTRNGSDSVSLGYGDDIYWFRVELTNTLKSEASNFLEIGYPVLDHVEVYREVD
GSMQEPLLLGDKRPFYDRPIHHRNFIVPLPLPPESTTTVYLRVDTTSSMQVPMTLWDQDA
FYSAEQARSLFEGIYYGIVLVMILYNLFVFMAVGERSFLYYVGYIAAMPLFLASLHGVTF
QYLWPEATWWNDQSIIVFLNLVVLFGGAFSIRFISVTRQNHPWLNRWTWAMIMTAGMLAL
AGLLIPYQWLILPSILVAFVGCSTMLMLSVVRWIKKDPAARYYTVAWVFMLFGGIVLALS
KFTMLPRNLLTENATQVGSALGVILLSIALADRLNREKKKSFAAQQKLLREERKARLAQE
KSLRIQQEANALLEERVQERTRDLEILNEQLLELSATDPLTGLKNRGHFDKKFQSDVVHA
YRFEETLSLLIVDIDHFKGFNDTYGHLVGDDCLKMVADCIKQHVTRPQDLAARYGGEEFV
VLLPDTPEAGACRVAELIREDIQKMAFRVSDQVLHLTVSIGVCSCAPSQADATKALFACA
DGALYRAKAEGRNRVVANTQAGQGLAVCQA
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgacgccagagactcatatgccaaggctctttgtcttattcagtctgctgtgttgcttg
ttggcaccgtctctttcgagtgccgaatcggtggagtggggccagttctccaagcgactg
gagctctcccgtttcgtcgactactggaaggaagagggcgcccggtcgatcgaagacgtt
cgtggtttgccggcccaggcctggacccggaacgggagcgacagcgtcagtctcggctat
ggcgacgacatctactggttccgcgtcgagctgaccaatactctgaaatctgaagccagc
aattttctggaaattggctacccggttctggaccacgttgaagtctatcgggaagtcgac
ggcagcatgcaggagcccttgctgctgggcgacaaacgtcccttctacgatcgcccgatt
caccaccgcaatttcattgttcccctgccattacctccggaatccaccaccacggtctat
ctgcgtgtggacactaccagctccatgcaggtgcccatgacgctctgggatcaggatgcc
ttctactcggcggagcaggcccggagcctgtttgagggcatctactacggcattgtcctg
gtgatgattctgtataacctgttcgtgttcatggccgtgggagagcgcagctttctatac
tacgtgggctacatcgcggccatgccgctgttcctggcatcgctgcatggtgtgacattc
cagtatttgtggccggaagcaacctggtggaatgaccagtccattattgttttcctgaac
ctggtggtgctgttcggtggcgccttcagtatccgcttcatcagtgttacccggcagaac
cacccctggctcaaccgctggacctgggccatgatcatgacggcgggcatgttggccctg
gccggtctcctgattccctatcagtggttgattcttccctccattctggtggcttttgta
ggttgttccaccatgctgatgctcagcgtggtgcgctggatcaagaaggatccagcggcc
cgttattacaccgtagcctgggtgttcatgctgttcggcgggattgtcctggcactgagc
aagttcaccatgttgccacgcaatctgctgaccgagaatgccacccaggtgggctcggct
cttggcgtgattctgctgtccattgcgctggctgatcgactgaaccgcgagaagaaaaaa
tcctttgctgcccagcagaagctgttgcgggaggagcgtaaggcccggctggcccaggaa
aaatcgcttcgtattcaacaggaagccaacgcactgctggaggaaagggtgcaggaacgg
acccgtgacttggaaatcctgaacgagcaactactggaactgagcgcgactgaccccctc
acaggattgaaaaaccgggggcacttcgacaagaaatttcagtccgacgtggtgcatgcc
tatcgattcgaggaaacgctgtcattgctgatagtggatattgatcacttcaagggcttc
aacgatacctacggccacctggtgggcgatgactgcctgaaaatggtggcggactgtatc
aaacaacacgtgacccggccgcaggatctggcggcccgatatggcggtgaggagttcgtt
gtgttattgccggatacgccggaagccggtgcctgtcgagtggctgagctaatccgggag
gatatccagaaaatggcgttccgggtgtccgatcaggtgcttcacctgaccgtcagcatc
ggtgtgtgcagctgtgcgccgagccaggcggacgccaccaaggcattattcgcctgtgcc
gatggtgcgctttatcgggccaaggcagaaggccgcaaccgggtggttgcaaacacccag
gccgggcagggcctggccgtctgtcaggcctga

DBGET integrated database retrieval system