KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_2168Help
Entry
Maqu_2168         CDS       T00454                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
maq00071  Fatty acid degradation
maq00280  Valine, leucine and isoleucine degradation
maq00281  Geraniol degradation
maq00310  Lysine degradation
maq00360  Phenylalanine metabolism
maq00362  Benzoate degradation
maq00380  Tryptophan metabolism
maq00410  beta-Alanine metabolism
maq00627  Aminobenzoate degradation
maq00640  Propanoate metabolism
maq00650  Butanoate metabolism
maq00903  Limonene and pinene degradation
maq00930  Caprolactam degradation
maq01100  Metabolic pathways
maq01110  Biosynthesis of secondary metabolites
maq01120  Microbial metabolism in diverse environments
maq01130  Biosynthesis of antibiotics
maq01212  Fatty acid metabolism
Module
maq_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:maq00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Maqu_2168
   00650 Butanoate metabolism
    Maqu_2168
  Lipid metabolism
   00071 Fatty acid degradation
    Maqu_2168
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Maqu_2168
   00310 Lysine degradation
    Maqu_2168
   00360 Phenylalanine metabolism
    Maqu_2168
   00380 Tryptophan metabolism
    Maqu_2168
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Maqu_2168
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Maqu_2168
   00281 Geraniol degradation
    Maqu_2168
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Maqu_2168
   00627 Aminobenzoate degradation
    Maqu_2168
   00930 Caprolactam degradation
    Maqu_2168
Enzymes [BR:maq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Maqu_2168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Gag_MA
Motif
Other DBs
NCBI-ProteinID: ABM19247
UniProt: A1U2M8
Position
complement(2430837..2431691)
Genome map
AA seq 284 aa AA seqDB search
MSELANYESFNIEVKDHIAHVQFSRPEALNTMNKAFWLELPRCVQDIEANTDARVIVISS
TGKHFSAGMDLGVFSDPKSVPMSGDPGRMAENLRRVVLQLQDTLSSLEKVRLPVLAAVHG
GCIGGALDLVCAADSRYCTSDAYFTIKETELGMTADVGTLQRLPKLMPEGVVRELAYTGR
KFGAEEAHRLGFVNSVYETQEAMLEGVMSIAAQIAANSPLAVTGCKEMINFSRDHSVEDS
LRYMATWQSGMFRPTDMMKSFQAKAQKQAPAYDDLFPVKGLFEN
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaactcgccaactacgaaagtttcaatattgaagtaaaagaccacatcgcccat
gttcagttcagtcgccctgaagcactgaacaccatgaacaaagcattctggctggagctg
ccgcgctgcgttcaggacattgaagccaataccgatgcccgggtgattgtgatctcctcg
actgggaagcacttttccgcaggcatggatctgggcgtgttctcggatccgaaatccgtg
cccatgagtggtgatcctggccgtatggcggagaacctgcgaagagtcgtactgcagctg
caggatactctgagctctcttgagaaagtacgtctgccggtgctggctgcggtgcacggg
ggctgtattggtggggctctggacctggtatgcgctgctgacagccggtattgcacctcc
gatgcctatttcaccatcaaggaaaccgagctgggcatgacagctgatgtgggcacgctg
cagcggttgcctaaactgatgcctgagggcgtggtgcgtgagctggcttacacgggccgc
aagttcggtgctgaagaagctcatcgcctgggtttcgtgaactcggtatacgagactcag
gaagcgatgcttgagggcgtgatgtccattgccgcccagattgctgccaattcaccgctg
gcggtgaccggctgcaaggaaatgatcaacttcagccgcgatcacagcgtagaagacagc
ctccgctacatggccacatggcaatccggcatgttccgccccacggacatgatgaaatcc
ttccaggccaaggcccagaaacaggcgcccgcctatgacgacctgttcccggtcaagggc
ctgttcgaaaactga

DBGET integrated database retrieval system