KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_2273Help
Entry
Maqu_2273         CDS       T00454                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:maq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Maqu_2273
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Maqu_2273
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Maqu_2273
Enzymes [BR:maq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Maqu_2273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2546179..2547579)
Genome map
AA seq 466 aa AA seqDB search
MRYISTRGEAPALGFEDVLLTGLATDGGLYVPESLPHFSLEEIRSWRGLPYAELAYKVMY
PFVEDAIPADDFRKMLDETYSVFSHQAVAPLVQLDTNEWVMELFRGPTLAFKDFALQLLG
RLLDYVLEKRNQHVVIMGATSGDTGSAAIEGCRRCEHVDIFILHPHQRVSEVQRRQMTTV
QGDNIHNIAVKGNFDDCQRMVKESFGNQSFLGGKTQLAAVNSINWARIMAQIVYYFQASL
ALGGPDRSMAFSVPTGNFGDIFAGYLAKKMGLPISQLVIATNRNDILHRFMSGNKYEQHQ
LEHTLSPSMDIMVSSNFERLLFDLHGRDGAAVKALLENAAKGPVSIEDYRWKHARKLFDS
DAVDDKTTCDTIRDVYEQNEYLLDPHTAIGVRAARNCRRDSAVPMITLGTAHPAKFPDAI
AESGLSVKPQLPAHMADLFEREERYTVLDNNVSEVQGFIAKHWKNA
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
gtgagatacatcagtacacggggtgaagctcccgcactgggctttgaggacgttcttctg
accgggctggccaccgatggtggcctctatgtgccggaatcgttgccgcacttcagcctg
gaagaaattcgtagctggcgtgggcttccctatgcggagctggcctataaagtgatgtat
ccgttcgtagaggatgccatcccggcggacgacttccgcaagatgctggatgaaacctac
agcgtgttcagccaccaggcggtggcaccgctggttcagctggacaccaacgagtgggtg
atggagctgttccgtggcccgacgctggcgttcaaagactttgccctgcagctgctgggc
cgcttgctggactacgttctggagaagcgcaaccagcacgttgtgatcatgggggccacc
tccggtgataccggttctgctgccatcgagggctgccgccggtgcgagcacgtggatatc
tttatcctgcatccgcatcagcgagtgtctgaagtgcagcgccgccagatgactacggtg
cagggcgacaacatccataacatcgcagtcaaaggcaacttcgacgactgtcagcgcatg
gtgaaggagagcttcggcaatcagtccttcctgggcggcaaaacccagctggcggcggtg
aactccatcaactgggcccggatcatggcccagatcgtgtactacttccaggcgtctctc
gctctgggtggcccggaccgcagcatggcgttctctgtgcccacaggcaactttggcgat
attttcgccggctacctggccaagaaaatggggctgcccatcagccaactggtgattgcc
accaaccgcaacgatatcctgcatcgcttcatgagcggcaacaagtatgagcagcaccag
ctggagcataccctgtcgccgagcatggacatcatggtgtccagcaacttcgagcgtctg
ctgtttgatctgcacggccgtgacggcgcggcggtcaaagccttgctggaaaacgcagcc
aaaggcccggtcagcattgaagactaccgctggaagcacgcccgcaagctgttcgacagc
gatgcggtggacgataaaaccacctgcgacaccattcgtgacgtctacgagcagaacgaa
tatctgctggacccgcacaccgccattggcgtacgcgctgcccgcaactgccgccgcgac
tctgctgtgcccatgatcaccctcggtaccgcgcacccggccaagttcccggatgcgatt
gccgaatccggcctgagcgtgaagccgcaattgccggctcacatggctgatctgttcgag
cgggaagagcgctacaccgtgctggataacaatgtgtctgaggtgcagggttttatcgcc
aagcattggaagaacgcctga

DBGET integrated database retrieval system