KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_2275Help
Entry
Maqu_2275         CDS       T00454                                 

Definition
protein-disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Brite
Enzymes [BR:maq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Maqu_2275
Secretion system [BR:maq02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Maqu_2275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2549033..2549767)
Genome map
AA seq 244 aa AA seqDB search
MNIKSVAVSIGLALTLVGAPASQAGEAEDRIAQRLTEAVPGLKVNSVRESEAKGLYEVQS
NNGDTIYTTEDGTYLLTGDLLKITENGIANVTEESRAGSRKDLMADYGGKGVISYPAKGK
EKAVVNVFTDIDCPYCRKLHDEVPQLNEYGITVNYYAFPRSGPGTASFNKYISVWCADDQ
QAAMDAAKAGRSVEQRSCENPVAEQYRLGGQVGVTGTPAILLEDGNMVRGYVPARNLAEG
LGIL
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcaaatcagtagcagtgtccattggactggcgctgaccctggtcggggcgcca
gcctcccaggcaggcgaagccgaagaccgcattgcccagcggctgaccgaggcggttccc
ggtctcaaggtgaactctgttcgtgaatctgaggcaaaagggttgtacgaagttcagagc
aacaacggcgacaccatctacaccacggaagacggcacctatctgctgacgggcgatctg
ctgaaaatcaccgaaaacggcattgccaacgttactgaagaatcccgtgcgggttcccgt
aaggacctgatggcggattacggtggcaagggcgtgatttcctatccggccaagggtaaa
gagaaggcggtcgttaatgtgtttaccgatatcgattgcccctattgccggaagttacac
gatgaagtgccccagttgaatgagtacggtattaccgtcaattactacgcgtttccccgt
tccgggccaggtacggcctccttcaataaatatatctcggtctggtgcgctgacgatcag
caggccgctatggatgccgccaaggccgggcgttcggtagagcagaggagttgtgagaac
ccggtggcagagcagtatcggctcggcggccaggttggtgtgaccggcacgccggctatt
ttgctggaagacggcaatatggttcggggttatgtgccggcccgaaatctggccgagggt
ctcggtattctgtga

DBGET integrated database retrieval system