KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_2305Help
Entry
Maqu_2305         CDS       T00454                                 

Definition
ATPase AAA
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:maq00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Maqu_2305
Enzymes [BR:maq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Maqu_2305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2574464..2576707)
Genome map
AA seq 747 aa AA seqDB search
MTSARLYTLVQVVKQRKGGCCFVHVLNTDGTIKKRKRSLIVRFSNQLGEVPVGSLWKVSG
HQIVNQFVVKGAVIYEDVLDATRASMLQPAKHTLSRWISLNIDGIGEIIANRLVRQRNLK
KWVRTNDTESLSLVPGMNPDLARRLIERWPDEGLHRTMDWLDALNLSPSLGFKLVRLFGK
EAVERLTDNPFLLLGLNVAYDQVLAVIEQLELELSHDTFVAGAAMHVVIKRMSANGSTVI
SDLLLRQSVEKLTGLVTTGDPGQAAVQQGLLVRVQDGYQVWGTALMEAAVASKLVKSLNR
PSGQGSLLASWEHQLSESALQAALKSYEQQLPFTLSEEQQQAVIGAVSAPVVGISGGAGT
GKTTILQAIISVYQALADGIACLPVALSGRAAQRMAQSTGMPAQTIAKLIADHLGEGKPL
LQDHLLIIIDEASMVDLLSMYRLVRILPEATRFIFLGDCAQLSPVGGGLVFHAMYDSPIP
FFELSQVRRQSVQSPVHRFAMAVRKGEVLIPEMALKTLPESPDCCVLPPSLDRLTHFWEA
AGALSDRIILSPRRSGDWGVTSLNTHFQKILGSERDDLHYLDPVKGWIPWITRFKQRLKL
GDPVLVTRNIYDDELDVRNGDLGIITEVFQSVSAEGWSGVVYINGERKGINQELLEVLDL
GYAISIHKAQGSQWHTVFSVVTSEARRMLDASMVYTAATRPTDRLILVTDAHSLRGAVSA
GNSASRRHVDLGRKLAMCAQTQFRDHV
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgacatctgcacgcctctacacccttgttcaagttgttaaacagcgcaaaggcggctgc
tgcttcgtccacgtgttgaacaccgatggcacaatcaaaaagcggaaacgctctttgatt
gtgcggttttctaaccaactcggcgaagttccggtcggctctttgtggaaagtcagcggt
caccagatcgtcaatcagttcgtggtgaagggggctgtgatctatgaggatgtgctcgat
gccacccgagcatctatgttgcagcccgccaaacacaccctaagccgctggataagcctt
aatatcgacggcattggcgagattatcgccaaccggttagtgcgccaacgcaatcttaaa
aagtgggtgcgtactaacgatacagagtcgctgagcctcgtccctggcatgaaccctgat
ctcgcccggcgcctgattgaacggtggccggatgaaggtttgcaccggactatggactgg
cttgatgccttgaatttgagtccttctttggggttcaagctagtcaggctatttggcaaa
gaggcggtggagcgattgacggacaatccgtttttactgctcggcctcaatgtggcctac
gatcaggttttggctgtgattgaacagcttgagctggaactgtcccatgacacttttgtt
gccggtgcggccatgcatgttgttatcaagcggatgagcgcaaatggctctacggtgatc
tcagatctgttgttgagacagtctgtagaaaagctaaccggcttagtgactactggcgat
cctggccaggcagccgttcagcagggcttgctggtccgagtgcaggatggataccaggtc
tgggggacagcgctcatggaggctgcagtggcgagtaaactggtaaagtccctgaaccgc
ccttcgggacagggttcgctgctcgcctcgtgggagcatcaattgagtgaatctgccttg
caagcagcgctaaaaagctacgagcagcagttaccctttacgctctcggaagaacagcaa
caagccgtaataggcgcggtatcggcccctgtcgtggggatatcgggaggcgcggggacc
gggaagactaccatcctccaagccattattagtgtgtaccaagcgttagctgatggcata
gcctgtttgccggtagctctctcaggccgtgcggcccaacgtatggcgcaaagcacgggg
atgcctgctcagactatcgccaaactgattgccgatcatctgggggaaggcaaaccccta
cttcaagatcatttgttaatcataattgatgaggcgtcgatggtggatctgctgtccatg
tatcggctagttcgcatattgcccgaggcaacgcgcttcatattcctaggcgactgcgcc
caactttcgcccgttggtggtgggctggtgttccacgccatgtatgactcaccaattcct
ttcttcgaactgtctcaggtgaggcgtcaatcggttcaaagcccagttcaccgctttgca
atggcggtgaggaagggagaggtattgattccagaaatggctttaaaaacgctccctgag
tcaccggactgttgtgttttacctccgtcactggatcgcctgacgcatttttgggaagct
gcgggcgctctcagcgaccgtatcattctgtctcctcgtcgttcaggcgattggggcgtg
accagtctcaatacccactttcaaaaaattctaggttcggagcgtgatgacctacattac
ctggatcccgtcaaaggttggataccttggattacgcgctttaagcaacgcttgaaactc
ggcgatccggtattggtgacgagaaacatctatgacgatgaactggacgttcgtaatggt
gatcttggcattatcactgaggttttccaaagtgtcagtgcggagggttggtctggagtt
gtttacataaatggtgagaggaaaggcatcaatcaagagctgctggaagtgttggatttg
gggtatgccatttccattcacaaagcacagggctctcagtggcacacggtattctctgtt
gttaccagcgaggctcgacgaatgcttgatgcgtcgatggtttacaccgctgcaacgcgt
ccgacagaccggctcatactggttaccgacgcgcactctttacggggcgctgtgagcgca
ggcaactcggccagtcggagacatgtggaccttgggaggaagttggcaatgtgtgctcaa
actcaatttcgcgatcacgtttaa

DBGET integrated database retrieval system