KEGG   Marinobacter aquaeolei: Maqu_2319Help
Entry
Maqu_2319         CDS       T00454                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
maq  Marinobacter aquaeolei
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:maq00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2591959..2593440)
Genome map
AA seq 493 aa AA seqDB search
MSRYLLAIDQGTTSSRAIVFDDKGAQVAVAQQEFHQYFPKDGWVEHDAMEIWDSTLAVCR
AALNNGKIKASDLAGIGITNQRETTVIWDRATGQPIHHAIVWQDRRTASWCTKLRQDGHE
SLVVDRTGLLIDPYFSATKIAWILDNVDGARQRAEAGELAFGTIDTWLLWNLTGGKHHRT
DATNASRTALFNIHTQQWDPQLLKLFRVPAALLPEVFDSAAEYGLTEPECLGASVMIAGI
AGDQHAALIGQACFEPGMAKSTYGTGCFLMLNTGQQALRSENRLLTTVAYRLNGKPCYAI
EGSIFVAGAAMQWLRDGLRLISHARESAEHAATVGVNNPVYLVPAFTGLGAPHWDPNARG
AILGLTRDTGIAEIVTAGLQSVCYQTKDLVRAIRNDGARLESLRVDGGMAVNDWVMQFLS
DILNVPVDRPSVTETTALGAAYLAGLQTGVFDSLEQITSLWECEHQFRPDMAPGLRESLY
AGWLDAVERVCNH
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgatatctgcttgccatagaccagggtaccaccagttcccgcgccatcgtgttt
gatgacaaaggcgctcaggtagccgttgcccagcaggagtttcaccagtacttccccaaa
gatggctgggttgagcacgatgccatggaaatctgggacagtacgctggcggtctgtcgt
gcagcgctgaacaacggcaagatcaaggcatctgacctcgcaggcatcggcattaccaac
cagcgggaaaccactgtgatctgggacagggcgacggggcagccgattcatcacgccatt
gtctggcaggatcgccgtaccgcgtcctggtgtaccaagttgcgccaggatggccacgaa
tccctggtggttgaccgcaccggattgttgattgatccctacttctctgccaccaagata
gcgtggattctggacaatgttgacggtgcccgccagcgcgcggaagcaggcgagttggcc
tttggcaccattgatacctggttgctatggaatctgaccggcggcaagcaccatcgtacc
gatgccaccaatgcgtcccgcactgcgctgttcaatatccatacacagcaatgggacccg
cagctgctcaagctgtttcgggtgcctgctgctctgttgccggaggtattcgacagtgca
gctgagtacgggttgacggaacccgaatgtctgggcgcgtcggtgatgattgccggtatt
gccggtgatcagcatgccgctttgatcggccaggcctgttttgagccggggatggccaag
agtacctatggcacaggctgtttcctgatgctcaacaccggccagcaggctctgcgctct
gaaaaccggttattgacgacagtagcctaccgcctcaacggcaaaccctgctatgccatt
gaaggcagtatttttgttgccggtgccgccatgcagtggctcagggatgggcttcggctg
atttcccatgcccgggaatcggcggagcatgcggcgacggttggtgtgaataatccggtg
tatctggtgcccgcgttcactggcctgggggccccgcactgggaccccaacgcccggggt
gcaatcctggggctgacccgggataccggcattgccgagattgtcacggcgggtttgcaa
tcggtgtgctatcagaccaaagacctggtgcgcgccattcgcaacgatggcgcccggctg
gaatcgctgcgagttgacggaggtatggctgtgaacgactgggtgatgcagtttttatcg
gacattctcaatgtgccggttgaccggccgagcgtgactgaaaccacggcgctgggggcc
gcatatcttgcgggtttgcagaccggggttttcgatagcctggagcagattacgtcgctt
tgggaatgcgagcaccagttccggccggatatggcgccggggctgcgggaatcactctat
gccggctggctggatgctgttgagcgagtctgtaatcactga

DBGET integrated database retrieval system