KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_2402Help
Entry
Maqu_2402         CDS       T00454                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:maq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Maqu_2402
   01230 Biosynthesis of amino acids
    Maqu_2402
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Maqu_2402
   00030 Pentose phosphate pathway
    Maqu_2402
   00051 Fructose and mannose metabolism
    Maqu_2402
   00052 Galactose metabolism
    Maqu_2402
  Energy metabolism
   00680 Methane metabolism
    Maqu_2402
Enzymes [BR:maq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Maqu_2402
Protein phosphatases and associated proteins [BR:maq01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Maqu_2402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
2686549..2687811
Genome map
AA seq 420 aa AA seqDB search
MAIKNAFYAQSGGVTAVINASACGVIQTARKHPDQIGKVYAGRNGIIGALKEELIDTSLE
SDDAIQALIHTPGGAFGSCRYKLKNISENQREYERLIEVFRAHDIGYFFYNGGGDSQDTA
YKVSQLADRMGYPITCIGVPKTVDNDLPFTDCCPGFGSVAKYIATSTLEASLDIKSMCET
STKVFILEVMGRHAGWIAAAGGLAGQSEGEPPHVILFPEIPFNREKFLERVDQCVRDYGY
CVVVASEGAQYEDGRFVADAGAKDAFGHTQLGGVAPALANMVKQALGHKYHWAVADYLQR
AARHIASATDVEQAYAVGKAAVEMALAGKQALMPTIVRDQAKPYRWSIGEANLSEVANQE
KKMPIHYITDNGFGITQDCRDYLQPLIAGESFPPFDDGLPRVAKLKNQLVEKKLRTEFEL
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggctatcaagaacgcattttatgcccagtctggcggggtcaccgccgttatcaatgcc
agtgcttgcggtgttatccagaccgcacgcaaacatccggaccagatcggcaaggtctat
gccggccgcaacggcatcatcggtgctttgaaagaagagctgattgataccagtctggaa
tctgacgacgccatccaggccctcatccacacgcccggcggggcttttggttcctgccgc
tacaagctcaagaacatttccgagaaccagcgcgaatacgagcgcctgattgaagtgttc
cgggcccacgacatcggttacttcttctacaacggcggcggcgattcccaggataccgcc
tataaggtctcccaactggccgatcgtatgggttacccgatcacctgcattggcgtgccc
aaaacggtcgacaacgaccttcccttcaccgactgctgtcccggctttggttccgtggcc
aagtacattgccacatccaccctcgaagccagcctggatatcaaatccatgtgtgaaacc
tccaccaaggtcttcattctggaagtgatgggtcgccacgccggctggattgctgccgct
ggcggactggccggacagagcgaaggcgagccgcctcacgtcatcctgttcccggaaatt
cccttcaaccgggagaaattcctggagcgagtagatcagtgcgtgagggattacggttac
tgcgtggtggtggcgtctgaaggcgcccaatacgaagacggccgcttcgttgccgatgcc
ggcgccaaggatgccttcggccacacccagcttggtggtgttgccccggccctggccaat
atggtgaaacaggccctgggccacaaataccactgggcagtggcagactatctgcagcgt
gcagccaggcacattgcctcggccactgatgtggagcaggcttacgcggttggcaaggct
gcggtggaaatggccctggcaggcaaacaggctctgatgcccaccatcgtgcgggatcag
gccaagccttatcgctggtcaatcggcgaggccaacctcagcgaggtcgccaaccaggaa
aagaaaatgccgatccattacatcacagacaacggctttggcatcactcaggattgccgg
gattacctgcagccgctgatcgccggcgaaagcttcccgccgtttgacgacggtctgccc
agggtggccaagctgaagaaccagctggtggagaagaaactgaggaccgagttcgaactc
tga

DBGET integrated database retrieval system