KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_2402Help
Entry
Maqu_2402         CDS       T00454                                 

Definition
(GenBank) pyrophosphate-dependent phosphofructokinase
  KO
K21071  
ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:maq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Maqu_2402
   00030 Pentose phosphate pathway
    Maqu_2402
   00051 Fructose and mannose metabolism
    Maqu_2402
   00052 Galactose metabolism
    Maqu_2402
  Energy metabolism
   00680 Methane metabolism
    Maqu_2402
Enzymes [BR:maq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Maqu_2402
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Maqu_2402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
2686549..2687811
Genome map
AA seq 420 aa AA seqDB search
MAIKNAFYAQSGGVTAVINASACGVIQTARKHPDQIGKVYAGRNGIIGALKEELIDTSLE
SDDAIQALIHTPGGAFGSCRYKLKNISENQREYERLIEVFRAHDIGYFFYNGGGDSQDTA
YKVSQLADRMGYPITCIGVPKTVDNDLPFTDCCPGFGSVAKYIATSTLEASLDIKSMCET
STKVFILEVMGRHAGWIAAAGGLAGQSEGEPPHVILFPEIPFNREKFLERVDQCVRDYGY
CVVVASEGAQYEDGRFVADAGAKDAFGHTQLGGVAPALANMVKQALGHKYHWAVADYLQR
AARHIASATDVEQAYAVGKAAVEMALAGKQALMPTIVRDQAKPYRWSIGEANLSEVANQE
KKMPIHYITDNGFGITQDCRDYLQPLIAGESFPPFDDGLPRVAKLKNQLVEKKLRTEFEL
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggctatcaagaacgcattttatgcccagtctggcggggtcaccgccgttatcaatgcc
agtgcttgcggtgttatccagaccgcacgcaaacatccggaccagatcggcaaggtctat
gccggccgcaacggcatcatcggtgctttgaaagaagagctgattgataccagtctggaa
tctgacgacgccatccaggccctcatccacacgcccggcggggcttttggttcctgccgc
tacaagctcaagaacatttccgagaaccagcgcgaatacgagcgcctgattgaagtgttc
cgggcccacgacatcggttacttcttctacaacggcggcggcgattcccaggataccgcc
tataaggtctcccaactggccgatcgtatgggttacccgatcacctgcattggcgtgccc
aaaacggtcgacaacgaccttcccttcaccgactgctgtcccggctttggttccgtggcc
aagtacattgccacatccaccctcgaagccagcctggatatcaaatccatgtgtgaaacc
tccaccaaggtcttcattctggaagtgatgggtcgccacgccggctggattgctgccgct
ggcggactggccggacagagcgaaggcgagccgcctcacgtcatcctgttcccggaaatt
cccttcaaccgggagaaattcctggagcgagtagatcagtgcgtgagggattacggttac
tgcgtggtggtggcgtctgaaggcgcccaatacgaagacggccgcttcgttgccgatgcc
ggcgccaaggatgccttcggccacacccagcttggtggtgttgccccggccctggccaat
atggtgaaacaggccctgggccacaaataccactgggcagtggcagactatctgcagcgt
gcagccaggcacattgcctcggccactgatgtggagcaggcttacgcggttggcaaggct
gcggtggaaatggccctggcaggcaaacaggctctgatgcccaccatcgtgcgggatcag
gccaagccttatcgctggtcaatcggcgaggccaacctcagcgaggtcgccaaccaggaa
aagaaaatgccgatccattacatcacagacaacggctttggcatcactcaggattgccgg
gattacctgcagccgctgatcgccggcgaaagcttcccgccgtttgacgacggtctgccc
agggtggccaagctgaagaaccagctggtggagaagaaactgaggaccgagttcgaactc
tga

DBGET integrated database retrieval system