KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_2457Help
Entry
Maqu_2457         CDS       T00454                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:maq00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Maqu_2457
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Maqu_2457
Enzymes [BR:maq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Maqu_2457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2743964..2745448)
Genome map
AA seq 494 aa AA seqDB search
MCITSISTLLQGIIEVPSVFDVTIHGLKTDSRKVRPGDAFIALAGARTPAEHYMDQAISA
GATAILLESEQERQCHERHGALIVPVVGLRARLGRIADRFFEHPSRHLRVIGVTGTNGKT
SVTQYISQLLRETGTPCGLLGTLGYGMPGSIESATHTTPDVVQVNRVLNRIRNEGGRAAV
MEVSSHALDQGRVDNLTMTGAVFTNLTRDHLDYHGSMEAYGEAKARLFLREELHFSVINF
DDPFGRQLYGQLEGQCDRVRYSLHEAQTELWLKEFTPTASGFRARVDGQWGEFDLTVPLL
GSFNASNVLAALATVLTLGVPVERAVSVVRELSPPPGRLERFTGSTGKHVVVDYAHTPDA
LANALEALRPHTRGRLICVFGCGGDRDPGKRPEMAKEAEKRADYVIVTDDNPRTEQPERI
VSDISAGFTQAGRWQVIHDRAQAIAEALGMANEDDLVLIAGKGHEAYQEIRGQKLPFSDA
EQVRHLLNLNGGVA
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgtgcatcacatccatcagcaccttgcttcagggcattattgaggtgccatcggtcttc
gatgtcactatccacggcctgaagacggatagccggaaagtgcggcccggtgacgccttt
attgctctggccggggcacgaacgcccgcagagcactatatggatcaggccatcagcgcc
ggtgccacggctattctgcttgagtccgagcaggagcggcagtgccatgagcgccacggc
gcgttgattgtgcccgtggttggtctgcgtgcccgtctgggccgaattgctgatcgcttc
ttcgagcatccctcgcgccatctgagagtgatcggggttaccggcaccaatggcaagacg
tcggtgacccaatacatctcccagttgttacgggaaaccggcacgccctgcgggctgctg
ggtaccctgggttatggcatgccgggcagtatcgagtcggccacgcataccacgccggat
gtggtccaggtgaaccgggtattgaaccgcatacgcaatgagggtggtcgggctgcagta
atggaagtgtcgtcgcacgctctggatcaggggcgggttgataacctgactatgaccggt
gcggtgttcaccaacctcacgcgtgatcacctggattaccacggttccatggaagcctat
ggtgaggccaaggccaggctgttcctgcgggaagaactgcacttctcagtgatcaatttt
gacgatccgtttggccggcagctttacggtcagcttgagggccagtgtgaccgcgttcgt
tacagtctgcatgaagcccagacggaactctggttgaaggaatttacgcccacggcctca
gggttccgtgccagggtcgatgggcaatggggcgagtttgatcttactgtccccctgtta
gggagtttcaatgccagcaatgttttggcagccctggctaccgtactgacgcttggcgta
ccggttgagcgggcggtgtccgttgtcagggagctgtcaccgccccctgggcgtcttgaa
cgattcaccggctcaaccggcaaacatgtggtggtggactacgcccacacgcctgatgcc
ctggccaatgcccttgaagcattgcggccccacacccggggcaggctgatctgtgtgttc
ggttgcggtggcgaccgggaccccggcaagcggcctgaaatggcgaaagaagcggaaaag
cgggcggattacgtcatcgtaaccgacgacaacccgcgtaccgagcagcctgaacggatt
gtcagcgacatttctgcaggtttcactcaggctggtcgctggcaggtgattcacgaccgc
gctcaggcaattgccgaggcattgggtatggccaatgaggatgatctggtgctgattgca
ggtaaaggtcatgaagcctatcaggagatccggggccagaagttgccgttcagcgacgcc
gagcaggtacgccatctattgaacctgaatggaggtgtggcatga

DBGET integrated database retrieval system