KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_2489Help
Entry
Maqu_2489         CDS       T00454                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
maq00071  Fatty acid degradation
maq00072  Synthesis and degradation of ketone bodies
maq00280  Valine, leucine and isoleucine degradation
maq00310  Lysine degradation
maq00362  Benzoate degradation
maq00380  Tryptophan metabolism
maq00620  Pyruvate metabolism
maq00630  Glyoxylate and dicarboxylate metabolism
maq00640  Propanoate metabolism
maq00650  Butanoate metabolism
maq00900  Terpenoid backbone biosynthesis
maq01100  Metabolic pathways
maq01110  Biosynthesis of secondary metabolites
maq01120  Microbial metabolism in diverse environments
maq01130  Biosynthesis of antibiotics
maq01200  Carbon metabolism
maq01212  Fatty acid metabolism
maq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:maq00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Maqu_2489
   00630 Glyoxylate and dicarboxylate metabolism
    Maqu_2489
   00640 Propanoate metabolism
    Maqu_2489
   00650 Butanoate metabolism
    Maqu_2489
  Lipid metabolism
   00071 Fatty acid degradation
    Maqu_2489
   00072 Synthesis and degradation of ketone bodies
    Maqu_2489
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Maqu_2489
   00310 Lysine degradation
    Maqu_2489
   00380 Tryptophan metabolism
    Maqu_2489
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Maqu_2489
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Maqu_2489
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Maqu_2489
Enzymes [BR:maq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Maqu_2489
Exosome [BR:maq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Maqu_2489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C Dodecin
Motif
Other DBs
NCBI-ProteinID: ABM19564
UniProt: A1U3J5
Position
2783317..2784525
Genome map
AA seq 402 aa AA seqDB search
MTTEAYIFDAVRTPRGRGKKDGSLHSVKPITLLTTVLKALEERNRLDTSQVDDVVMGCVT
AVGDQGADIAKTAALAADWDEKVAGVTLNRFCASGLEAVNLAAMKVRSGWEDMVVAGGVE
AMSRVPMGSDGGAWATDPETNLHTGFMPQGIGADLIATLEGFSREDVDGFAVKSQQKAAN
AWEKGYFAKSIVPVTDQNGVVILDRDEHVRGNTTVESLAGLKPSFQMMGEMGFDGVAREK
YHYVEKINHVHHAGNSSGIVDGATAMLIGSEAKGKELGLKPRARIVATAVTSTDPTIMLT
GPAPAARKALEKAGMTVDQIDLFEVNEAFASVVMRFQKELSVPDEKVNVNGGAIAMGHPL
GATGAIILGTLLDELERRELRYGLATLCVGGGMGIATIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgaggcgtacattttcgatgccgttcgcaccccccgcggccgcggcaagaaa
gatggctcactgcacagcgttaagccgatcacgctgctcactaccgtgctcaaggctctg
gaagagcgtaaccggctcgacacttctcaggtagatgatgtcgtcatgggctgcgtcacc
gccgtgggtgaccagggcgcggatatcgccaagacggcggcactggccgctgactgggat
gagaaagtcgccggagtaaccctgaaccgcttctgcgcctccggcctggaagccgtgaac
ctggccgccatgaaagtgcgctccgggtgggaagacatggtggttgccggtggtgtcgag
gcgatgtctcgcgtacccatgggttccgatggaggcgcctgggccaccgatccggaaacc
aacctgcacaccggcttcatgccccagggcattggcgcagacctgatcgcgaccctggaa
ggcttcagtcgtgaagatgtcgacggctttgcggtgaaatcccagcaaaaagccgccaat
gcctgggaaaaggggtacttcgccaaatccatcgtgccagttaccgaccagaacggcgtt
gtcatcctggaccgggacgagcacgtgcgcggcaacacgaccgtcgaatccctggcaggc
ctcaagccctcgttccagatgatgggcgagatgggctttgacggcgtcgcccgggaaaaa
taccactacgtggagaagatcaaccacgtgcaccacgccggcaactcttccggcattgtc
gacggtgccaccgccatgctgattggcagcgaagccaagggcaaggaactcggcctgaag
ccacgcgcccgcatcgttgccactgcggttaccagcacagaccccaccattatgctcacc
ggccctgccccggctgcccgcaaggcactggagaaagccggtatgacggtggaccagatc
gacctgtttgaagtgaacgaagccttcgcctcggtggtgatgcgcttccagaaagaactg
tccgttccggacgagaaagtgaatgtaaacggcggcgccatcgccatgggccacccgctg
ggtgctactggcgccatcatcctcggcaccctgctggatgaactggaacgccgtgaactg
cgctacggcctggccaccttgtgtgtgggcggtggcatgggcattgccaccatcatcgag
cgcgtctga

DBGET integrated database retrieval system