KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_2490Help
Entry
Maqu_2490         CDS       T00454                                 

Definition
(GenBank) short chain enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
maq00071  Fatty acid degradation
maq00280  Valine, leucine and isoleucine degradation
maq00281  Geraniol degradation
maq00310  Lysine degradation
maq00362  Benzoate degradation
maq00380  Tryptophan metabolism
maq00410  beta-Alanine metabolism
maq00640  Propanoate metabolism
maq00650  Butanoate metabolism
maq00903  Limonene and pinene degradation
maq00930  Caprolactam degradation
maq01040  Biosynthesis of unsaturated fatty acids
maq01100  Metabolic pathways
maq01110  Biosynthesis of secondary metabolites
maq01120  Microbial metabolism in diverse environments
maq01130  Biosynthesis of antibiotics
maq01200  Carbon metabolism
maq01212  Fatty acid metabolism
Module
maq_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:maq00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Maqu_2490
   00650 Butanoate metabolism
    Maqu_2490
  Lipid metabolism
   00071 Fatty acid degradation
    Maqu_2490
   01040 Biosynthesis of unsaturated fatty acids
    Maqu_2490
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Maqu_2490
   00310 Lysine degradation
    Maqu_2490
   00380 Tryptophan metabolism
    Maqu_2490
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Maqu_2490
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Maqu_2490
   00281 Geraniol degradation
    Maqu_2490
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Maqu_2490
   00930 Caprolactam degradation
    Maqu_2490
Enzymes [BR:maq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Maqu_2490
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Maqu_2490
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Maqu_2490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 ECH_2 3HCDH NAD_binding_2 F420_oxidored UDPG_MGDP_dh_N AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ABM19565
UniProt: A1U3J6
Position
2784554..2786704
Genome map
AA seq 716 aa AA seqDB search
MSAIQYDLGSDQILTLTIDMPGQSANTMNGEFRTALTETVNKVKSDLDNVKGIIIASAKK
SFFAGGDLNELYTVTREQAKEFEDMVNGLKADMRTLETCGKPVVAAINGTALGGGLELAL
ACHHRVAIDDDRTQLGLPEVTLGLLPGGGGTQRLPRMIGLEAAFPFLMEGKKVNPKAALK
AGIVDELASSPEDMIAKARAFIEANPKCQQPWDQKGFRFPGGAPHHPAMAQKLAIAPAML
KQKTKGCYPAPERILAAAVEGAQVDFDNGSLIETRYFAELATGQVAKNMTGTFWFQLNAI
KAGGSRPDGVEKESFKKVGVLGAGMMGAGIAYSTASRGIEVVLKDVSVENAEKGKRYSEN
LLAKKVSRGRMTEAQKDEVLARINATASADDLEGCDLIIEAVFEDSDLKAKVTRESEPKM
VANGIFASNTSTIPITQLAQASAKPDNFIGLHFFSPVDKMQLVEIIVGEKTSDDTLARAF
DYVQQIGKIPIVVNDSRGFFTSRVFGTFVNEGISMLAEGIHPSSIENAGLLAGMPVGPLA
ISDEVSMTLMQHIRAQSKKDTEAAGGTWQPHPAEAVIDAMVDTHGRKGKAAGAGFYEYPE
KGKKYLWPELENLFVDQDKARRVKLQDLKDRILFMQAIETIRCLEEGVLRTVEDANIGSI
FGIGYAPWTGGAIQFVNQYGVRAFAERAQQLADQYGERFTPPSLLLQKAERNETFS
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgagtgccatccaatacgacctgggttcagaccagattctgaccctgaccatcgacatg
ccgggccagtctgcgaacaccatgaacggcgagtttcgaactgcactaaccgaaaccgtc
aacaaggtcaaaagcgacctggataatgtcaaaggcattatcattgcctccgccaagaaa
agcttctttgccggcggcgacctgaatgagctgtacacagtgacccgcgaacaggccaaa
gagtttgaagacatggtcaacggcctgaaggccgatatgcgtacgctggaaacctgtggc
aaacctgtggtggctgccatcaacggcaccgctctgggtggtggcctggaactcgccctg
gcctgccatcatcgcgttgccattgatgatgaccggacccaactgggcttgccggaagtc
accctgggcctgctgcccggcggtggcggcacccagcgactgccccggatgattggcctg
gaagccgccttcccgttcctgatggagggtaagaaggtaaatccaaaagccgctctgaag
gccggtatcgtggatgagctggccagctcaccggaagacatgatcgccaaggcccgggcc
ttcatcgaagccaatcccaagtgccagcaaccctgggatcagaaaggcttccgcttcccc
ggcggagctccgcatcatccggccatggcccagaaactggctattgcaccggccatgctc
aaacagaagaccaaaggctgctatccggcaccggaacggattctggcagcagcggtggaa
ggcgcccaggtggatttcgacaatggcagcctgattgaaacccgttactttgccgagctg
gccaccggccaggtggccaagaacatgacgggcaccttctggttccagctcaacgccatc
aaggccggcggcagtcgcccggatggcgtagaaaaggaaagcttcaagaaagtcggggta
ctgggtgcaggcatgatgggcgccggtatcgcctactccactgccagccgcggcattgag
gtggtgctgaaggatgtctcggttgaaaacgccgagaaaggcaaacgctattccgaaaat
ctcctggcgaagaaagtcagtcgcggccgcatgaccgaagcccagaaagacgaagtgttg
gcccgcatcaacgccaccgcctctgccgacgacctggaaggttgcgacctgatcatcgag
gcagtctttgaagacagcgatctgaaggcaaaggttacccgggaatccgagccgaaaatg
gtcgctaacggcatctttgcctccaacacctcaaccatccccatcacccagttggcccag
gcctcggccaagccggacaactttatcggcctgcacttcttctccccggtggacaagatg
caactggtggaaatcatcgtcggcgagaaaacctccgatgacaccctggcccgggcgttc
gattacgtgcagcagataggcaagattcccattgtggtgaacgacagccgcggcttcttt
acctctcgggtatttggcaccttcgtgaacgaaggtatcagcatgctggccgagggcatt
cacccctcaagcatcgagaatgccggactgctggccggcatgccggtcgggccgctggcc
atctccgacgaagtcagcatgaccctgatgcagcacatccgcgcccaaagcaagaaagac
acggaagccgccggcggtacctggcagccgcatccggccgaagccgtcatcgatgccatg
gtggatactcacggacgcaagggcaaagccgccggtgccggtttctacgagtatccggag
aagggcaaaaaatacctgtggccggaactggagaacctgttcgtggaccaggacaaggca
cgccgtgtgaagctgcaggatctgaaagatcgcatcctgttcatgcaggccatcgagacc
atccgctgtcttgaggagggtgtgctgagaaccgtggaagacgccaacattggcagcatc
ttcggtattggctacgcgccctggaccggcggtgccatccagttcgtcaaccagtatggc
gttcgggcctttgcggagcgggcgcagcagctggcagaccagtacggtgagcgattcacg
ccgccatcgctgttgcttcagaaagccgaacgcaacgaaacctttagctga

DBGET integrated database retrieval system