KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_2490Help
Entry
Maqu_2490         CDS       T00454                                 

Definition
3-hydroxyacyl-CoA dehydrogenase
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:maq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Maqu_2490
   01212 Fatty acid metabolism
    Maqu_2490
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Maqu_2490
   00650 Butanoate metabolism
    Maqu_2490
  Lipid metabolism
   00071 Fatty acid degradation
    Maqu_2490
   01040 Biosynthesis of unsaturated fatty acids
    Maqu_2490
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Maqu_2490
   00310 Lysine degradation
    Maqu_2490
   00380 Tryptophan metabolism
    Maqu_2490
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Maqu_2490
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Maqu_2490
   00281 Geraniol degradation
    Maqu_2490
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Maqu_2490
Enzymes [BR:maq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Maqu_2490
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Maqu_2490
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Maqu_2490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2784554..2786704
Genome map
AA seq 716 aa AA seqDB search
MSAIQYDLGSDQILTLTIDMPGQSANTMNGEFRTALTETVNKVKSDLDNVKGIIIASAKK
SFFAGGDLNELYTVTREQAKEFEDMVNGLKADMRTLETCGKPVVAAINGTALGGGLELAL
ACHHRVAIDDDRTQLGLPEVTLGLLPGGGGTQRLPRMIGLEAAFPFLMEGKKVNPKAALK
AGIVDELASSPEDMIAKARAFIEANPKCQQPWDQKGFRFPGGAPHHPAMAQKLAIAPAML
KQKTKGCYPAPERILAAAVEGAQVDFDNGSLIETRYFAELATGQVAKNMTGTFWFQLNAI
KAGGSRPDGVEKESFKKVGVLGAGMMGAGIAYSTASRGIEVVLKDVSVENAEKGKRYSEN
LLAKKVSRGRMTEAQKDEVLARINATASADDLEGCDLIIEAVFEDSDLKAKVTRESEPKM
VANGIFASNTSTIPITQLAQASAKPDNFIGLHFFSPVDKMQLVEIIVGEKTSDDTLARAF
DYVQQIGKIPIVVNDSRGFFTSRVFGTFVNEGISMLAEGIHPSSIENAGLLAGMPVGPLA
ISDEVSMTLMQHIRAQSKKDTEAAGGTWQPHPAEAVIDAMVDTHGRKGKAAGAGFYEYPE
KGKKYLWPELENLFVDQDKARRVKLQDLKDRILFMQAIETIRCLEEGVLRTVEDANIGSI
FGIGYAPWTGGAIQFVNQYGVRAFAERAQQLADQYGERFTPPSLLLQKAERNETFS
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgagtgccatccaatacgacctgggttcagaccagattctgaccctgaccatcgacatg
ccgggccagtctgcgaacaccatgaacggcgagtttcgaactgcactaaccgaaaccgtc
aacaaggtcaaaagcgacctggataatgtcaaaggcattatcattgcctccgccaagaaa
agcttctttgccggcggcgacctgaatgagctgtacacagtgacccgcgaacaggccaaa
gagtttgaagacatggtcaacggcctgaaggccgatatgcgtacgctggaaacctgtggc
aaacctgtggtggctgccatcaacggcaccgctctgggtggtggcctggaactcgccctg
gcctgccatcatcgcgttgccattgatgatgaccggacccaactgggcttgccggaagtc
accctgggcctgctgcccggcggtggcggcacccagcgactgccccggatgattggcctg
gaagccgccttcccgttcctgatggagggtaagaaggtaaatccaaaagccgctctgaag
gccggtatcgtggatgagctggccagctcaccggaagacatgatcgccaaggcccgggcc
ttcatcgaagccaatcccaagtgccagcaaccctgggatcagaaaggcttccgcttcccc
ggcggagctccgcatcatccggccatggcccagaaactggctattgcaccggccatgctc
aaacagaagaccaaaggctgctatccggcaccggaacggattctggcagcagcggtggaa
ggcgcccaggtggatttcgacaatggcagcctgattgaaacccgttactttgccgagctg
gccaccggccaggtggccaagaacatgacgggcaccttctggttccagctcaacgccatc
aaggccggcggcagtcgcccggatggcgtagaaaaggaaagcttcaagaaagtcggggta
ctgggtgcaggcatgatgggcgccggtatcgcctactccactgccagccgcggcattgag
gtggtgctgaaggatgtctcggttgaaaacgccgagaaaggcaaacgctattccgaaaat
ctcctggcgaagaaagtcagtcgcggccgcatgaccgaagcccagaaagacgaagtgttg
gcccgcatcaacgccaccgcctctgccgacgacctggaaggttgcgacctgatcatcgag
gcagtctttgaagacagcgatctgaaggcaaaggttacccgggaatccgagccgaaaatg
gtcgctaacggcatctttgcctccaacacctcaaccatccccatcacccagttggcccag
gcctcggccaagccggacaactttatcggcctgcacttcttctccccggtggacaagatg
caactggtggaaatcatcgtcggcgagaaaacctccgatgacaccctggcccgggcgttc
gattacgtgcagcagataggcaagattcccattgtggtgaacgacagccgcggcttcttt
acctctcgggtatttggcaccttcgtgaacgaaggtatcagcatgctggccgagggcatt
cacccctcaagcatcgagaatgccggactgctggccggcatgccggtcgggccgctggcc
atctccgacgaagtcagcatgaccctgatgcagcacatccgcgcccaaagcaagaaagac
acggaagccgccggcggtacctggcagccgcatccggccgaagccgtcatcgatgccatg
gtggatactcacggacgcaagggcaaagccgccggtgccggtttctacgagtatccggag
aagggcaaaaaatacctgtggccggaactggagaacctgttcgtggaccaggacaaggca
cgccgtgtgaagctgcaggatctgaaagatcgcatcctgttcatgcaggccatcgagacc
atccgctgtcttgaggagggtgtgctgagaaccgtggaagacgccaacattggcagcatc
ttcggtattggctacgcgccctggaccggcggtgccatccagttcgtcaaccagtatggc
gttcgggcctttgcggagcgggcgcagcagctggcagaccagtacggtgagcgattcacg
ccgccatcgctgttgcttcagaaagccgaacgcaacgaaacctttagctga

DBGET integrated database retrieval system