KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_2554Help
Entry
Maqu_2554         CDS       T00454                                 

Definition
(GenBank) succinyldiaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
maq00300  Lysine biosynthesis
maq01100  Metabolic pathways
maq01120  Microbial metabolism in diverse environments
maq01230  Biosynthesis of amino acids
Module
maq_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:maq00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Maqu_2554
Enzymes [BR:maq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Maqu_2554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: ABM19629
UniProt: A1U3R0
Position
2857400..2858530
Genome map
AA seq 376 aa AA seqDB search
MSLSPTLELAKDLIRRQSVTPDDAGCQELMMSRLAPLGFSGENLRFGETDNLWARKGNNG
PVLAFAGHTDVVPTGPEKNWAHPPFDPIIKDGYLHGRGAADMKGSLAAFITACERFVANH
PNHRGSIALLITSDEEGPAQDGTVKVVETLEARNEKMDWCLIGEPSSTHQVGDVIKNGRR
GSLHGYLTVRGVQGHVAYPHLAENAVHNVAPALDALAKEFWDNGNDFFPPTTFQITRVEA
GVGSNIVPGECLVHFNFRYCTENTAESLEERVVAILDRHNLKYDLQWHLSGRPFLTDKGA
LVSAAQNAIRTVTGRETELSTSGGTSDGRFIAPTGAQVVELGPINATIHKVDECVKAEDL
DTLSEIYEQILVELLA
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctctcccccaccctggaacttgccaaggaccttatccgccgccaatccgtaacg
ccggacgacgcgggctgccaggaactcatgatgtcacgcctggcgccgctgggtttcagt
ggggaaaacctgcgctttggcgaaaccgacaacctgtgggcaagaaagggcaacaatggg
ccggttctggcatttgccggccacaccgacgtggtacccaccggccccgagaaaaactgg
gcgcacccgccgtttgacccgatcatcaaggacggctacctgcacggtcggggcgcagcg
gacatgaagggaagcctggcggccttcatcaccgcctgtgaacgatttgtggccaaccac
ccgaatcatcggggctcgattgccctgctgatcaccagcgatgaggaaggcccggcccag
gatggcaccgtaaaagtggtggaaaccctcgaagcccgcaatgagaaaatggactggtgc
ctgattggcgaaccgtccagcacccaccaggtaggggatgtcatcaagaatggccggcgc
ggctcccttcacggatacctcaccgttcgcggcgttcagggccacgtggcctacccgcat
ctggccgagaatgccgtccacaacgttgcaccggcactggacgcgttggccaaggaattc
tgggacaacggcaacgacttcttcccgcctaccaccttccagataactcgtgtcgaggcc
ggcgtcggcagcaatattgtgcccggggagtgcctggtgcacttcaacttccgttactgc
accgagaacaccgcggaaagcctggaagagagagtggtcgctatcctggatcggcacaac
ctgaaatacgatctgcaatggcacctcagtggccggccattcctgaccgacaaaggcgcg
ctggtatcggccgcacagaatgccattcgaaccgtgactggccgtgagacagaactgtct
acgtccggcggcacctcagacggtcgcttcattgcgcccaccggtgcccaggtggtcgaa
cttggcccgatcaacgccaccattcacaaggtggacgagtgtgtgaaggctgaggacctg
gacacactatccgagatctacgaacagattctggtcgagctgctggcctaa

DBGET integrated database retrieval system