KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_2628Help
Entry
Maqu_2628         CDS       T00454                                 

Definition
(RefSeq) dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
  KO
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:maq00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Maqu_2628
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Maqu_2628
Enzymes [BR:maq01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Maqu_2628
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2958916..2959476)
Genome map
AA seq 186 aa AA seqDB search
MNVVETPLEGVLILEPRVFGDDRGWFYESFNAERFADAVGKPVAFVQDNHSRSAKGVLRG
IHFQTGRAAQGKLVRATFGEVFDIAVDLRKSSPTFGQWTGVLLSAENKRQLWVPAGFGHA
FLVTSDVAEVQYKVDAYWSAEHERSLRWDDPAVAVEWPEVGEVQLSEKDRHAPDLNVLNA
EGDLFE
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaatgttgtggaaaccccgctggaaggggtgctgattctggaacccagggtgttcggc
gatgaccggggctggttctacgagagttttaatgccgagcgctttgccgatgctgttggt
aagcctgttgcatttgttcaggataatcattcccgctccgccaaaggtgtgcttagggga
attcatttccagaccggtcgtgcggcccagggcaaattggtgcgcgcaacgtttggtgag
gtgttcgatatcgccgtggatctgcgcaaaagttcgcctacgttcgggcagtggaccggg
gtgcttttgagtgcggaaaacaaacggcagttgtgggttcccgccggtttcgggcatgcc
tttctggtaaccagtgatgtcgcggaagtgcaatacaaggtcgatgcctattggtctgct
gagcacgagcgcagccttcgctgggatgaccctgcggtggccgttgagtggccggaggta
ggcgaggtgcagctgtccgagaaagaccgacatgcgccagacctgaacgttttgaatgca
gagggtgatttgtttgagtaa

DBGET integrated database retrieval system