KEGG   Marinobacter aquaeolei: Maqu_2703Help
Entry
Maqu_2703         CDS       T00454                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
maq  Marinobacter aquaeolei
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:maq00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:maq00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3029680..3030942)
Genome map
AA seq 420 aa AA seqDB search
MDKLLIRGRKPLDGEIRISGAKNAALPILAATLLADEPVTVGNLPHLNDITTMIELLGRM
GVELLIDEKMSVEVHANTIKHFHAPYELVKTMRASILVLGPLVAHFGEAEVSLPGGCAIG
TRPVNLHIHGLEMMGADIKVENGYIKAKTNGRLKGAHIFLDTVTVTGTENLMMAAALAEG
KTILENAAREPEVVDLAECLIAMGADIKGHGTATIEINGVERLHGCHYNVLPDRIETGTY
LVAAAATGGRVKVKDTREDILEAVLLKLEEAGAHITTGPDWIELDMKGKRPKAVSLRTAP
YPAFPTDMQAQFAAMNAVAEGSGTIVETVFENRFMHLQELIRMGADITLEGNAAIIKGVE
HLTGAPVMATDLRASASLVIAGLMADGDTIVDRIYHIDRGYECIEEKLQLLGASIRRLPA
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtggacaaactattgatcaggggtcgaaagcccctggatggcgaaattcgcatttccggt
gccaagaacgcggccctgcccattctggcggcgacactgctggcggatgagccggttacc
gtcggcaacctgccgcacctgaacgatattaccaccatgatcgagctgctcggtcgcatg
ggggtggagctgctcattgacgaaaagatgagtgttgaagtgcacgccaacaccatcaag
cacttccatgcaccgtacgagctggtaaagaccatgcgcgcctccatactggtgcttggc
ccgctggtggcacattttggcgaagccgaagtctccctgccgggtggctgtgccatcggt
acccgaccggttaacctgcacatccacggtctggaaatgatgggtgccgacataaaggtg
gagaatggttacatcaaggccaagaccaatggccggctgaagggtgcccacatcttcctg
gatacggtcaccgtaacgggtaccgaaaacctgatgatggcagctgcgctcgccgagggt
aaaaccatcctcgaaaacgcggcccgtgagccggaagtggtggatctggccgagtgcctg
atcgccatgggtgccgatatcaaaggccacggtaccgcgaccattgaaatcaatggtgtg
gagcgcctgcacggatgccactacaacgtgctgccggaccggatcgagaccggaacctac
ctggtggcggcggctgcgaccggtggtcgggtgaaagtaaaagatacccgggaagatatc
ctggaagcggtgctgctcaagctggaagaggcgggggcgcacatcacgaccggcccggac
tggattgaactggacatgaaaggcaagcggcccaaggctgtcagcctgcggaccgcgccg
tatccggcgttcccaacggatatgcaggctcagtttgcggccatgaatgcggtcgccgag
ggttccggaaccatcgtcgaaaccgtatttgaaaaccgcttcatgcacttgcaggaactg
atccggatgggtgcagacattacccttgaaggtaatgcggccatcatcaagggcgttgaa
cacctgaccggtgctccggtgatggcaaccgatctgcgggcctcagccagcctcgtgatc
gccggtctgatggcagacggcgataccattgtcgaccgcatttaccacattgaccgcggt
tacgaatgcattgaagagaaattgcagctgttgggtgccagcatccgccgtctgccagcc
tga

DBGET integrated database retrieval system